DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp9b1 and cyp4t8

DIOPT Version :9

Sequence 1:NP_523645.1 Gene:Cyp9b1 / 35634 FlyBaseID:FBgn0015038 Length:505 Species:Drosophila melanogaster
Sequence 2:NP_954686.2 Gene:cyp4t8 / 387527 ZFINID:ZDB-GENE-031219-3 Length:509 Species:Danio rerio


Alignment Length:446 Identity:112/446 - (25%)
Similarity:183/446 - (41%) Gaps:63/446 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    70 KLVGLFNLRTPM--------IQINDPQLIKKICV----KD---FDHFPNHQTLNIPNERLVNDML 119
            |.:.|:....|:        :.|:.|..:|.|..    ||   :..|       ||   .:.|.|
Zfish    72 KWMELYQFAFPLWFGPSLAVLNIHHPSYVKTILTTTEPKDDYAYKFF-------IP---WLGDGL 126

  Fly   120 NVMRDQHWRNMRSVLTPVFTSAKMRNMFTLMNESFAQCLE----HLKSSQPIAAGENAFELDMKV 180
            .|...|.|...|.:|||.|....::....|:::|....|:    |.:|       |.:|||...|
Zfish   127 LVSTGQKWFRHRRLLTPGFHYDVLKPYVKLISDSTKVMLDKWEVHSRS-------EESFELFKHV 184

  Fly   181 LCNKLSNDVIATTAFGLKVN-SFDDPENEF--------HTIGKTLAFSRGLPFLKFMMCLLAPKV 236
              :.::.|.|...||....| ..|...|.:        |.:  .|.| |..|:....:..|:|..
Zfish   185 --SLMTLDSIMKCAFSCNSNCQTDSGTNPYIQAVFDLCHLV--NLRF-RVFPYHSKAIFHLSPHG 244

  Fly   237 FNFFKLTIFDSTNVEYFVRLVVDAMQYREKHNITRP----DMIQLLMEAKKESKDNWTDDEIVAQ 297
            :.|.|.......:....:|...:.::..|:..|.:.    |.:.:|:.|:.|.:...:|::|.|:
Zfish   245 YRFRKAASIAHNHTAEVIRKRKEVLKMEEEQGIVKNRRYLDFLDILLSARDEHQQGLSDEDIRAE 309

  Fly   298 CFIFFFAAFENNSNLICTTAYELLRNLDIQERLYEEVKETQEALKG-APLTYDAAQEMTYMDMVI 361
            ...|.|...:..::.|....|.|..|.:.||:..:|:   |:||.| |.|.::...::.|..|.|
Zfish   310 VDTFMFEGHDTTASGISWIFYNLACNPEHQEKCRQEI---QQALDGKATLEWEDLNKIPYTTMCI 371

  Fly   362 SESLRKWTLSAAADRLCAKDYTLTDDEGTKLFEFKAGDNINIPICGLHWDERFFPQPQRFDPERF 426
            .||||.........|...|..|..|  |..:.|   |..|.:.|.|:|.:...:..|.:|||.||
Zfish   372 KESLRLHPPVPGISRKLTKPLTFFD--GRTVPE---GCTIGVSIYGIHMNSTVWENPYKFDPLRF 431

  Fly   427 SERRKKDLIPYTYLPFGVGPRSCIGNRYAVMQAKGMLYNLMLNYKIEASPRTTRDM 482
            ......:..|:.::||..|||:|||..:|:.:.|..:...:..|.:...|..|..|
Zfish   432 LPENVANRSPHAFVPFSAGPRNCIGQNFAMNEMKVAVALTLKRYYLIKDPDHTPKM 487

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp9b1NP_523645.1 p450 37..478 CDD:299894 110/440 (25%)
cyp4t8NP_954686.2 p450 46..501 CDD:306555 112/446 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100014
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.