DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp9b1 and Cyp4ad1

DIOPT Version :9

Sequence 1:NP_523645.1 Gene:Cyp9b1 / 35634 FlyBaseID:FBgn0015038 Length:505 Species:Drosophila melanogaster
Sequence 2:NP_610380.1 Gene:Cyp4ad1 / 35821 FlyBaseID:FBgn0033292 Length:516 Species:Drosophila melanogaster


Alignment Length:515 Identity:110/515 - (21%)
Similarity:207/515 - (40%) Gaps:90/515 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSFVEICLVLATI----GLLLFKW---STGTFKAFEGRNLYFEKPYPFLGNMAASALQKASFQKQ 58
            |..:.|.::||||    |:.:|.:   ..|..:...|     ..||||:||:....|:.|.:.|:
  Fly     1 MFLIAIAIILATILVFKGVRIFNYIDHMAGIMEMIPG-----PTPYPFVGNLFQFGLKPAEYPKK 60

  Fly    59 ISEFYNRTRHHKLVGLFNLRTPMIQINDPQLIKKICVKDFDHFPNHQTLNIPNERLVNDMLNVMR 123
            :.::..:........|..|:..|: ::||..|:.|.......:..|  |.......:.|.|....
  Fly    61 VLQYCRKYDFQGFRSLVFLQYHMM-LSDPAEIQNILSSSSLLYKEH--LYSFLRPWLGDGLLTSS 122

  Fly   124 DQHWRNMRSVLTPVFTSAKMRNMFTLMNES---FAQCLEHLKSSQPIAAGENAFELDMKVLCNKL 185
            ...|...:.:..|.|..:.:.....:::.:   |.|.|:.|..:|.:        .|.:.|..|.
  Fly   123 GARWLKHQKLYAPAFERSAIEGYLRVVHRTGGQFVQKLDVLSDTQEV--------FDAQELVAKC 179

  Fly   186 SNDVIATTAFGLKVNSFDDPENEFHTIGKTLAFSRGLPFLKFMMC-LLAPKVFNFFKLTIFDSTN 249
            :.|::...|.|...:|.:...::.|...|.|             | ::..:.|:..|.  ||:  
  Fly   180 TLDIVCENATGQDSSSLNGETSDLHGAIKDL-------------CDVVQERTFSIVKR--FDA-- 227

  Fly   250 VEYFVRLVVDAMQYREKHNITRPDM---------------------------IQLLMEAKKESKD 287
               ..||....|:.|...::.|.::                           :.:|:.||.:.| 
  Fly   228 ---LFRLTSYYMKQRRALSLLRSELNRIISQRRHQLAAENTCQQGQPINKPFLDVLLTAKLDGK- 288

  Fly   288 NWTDDEIVAQCFIFFFAAFENNSNLICTTAYELLRNLDIQERLYEEVKETQEALKGAPLTYDA-- 350
            ...:.||:.:...|.|...:..:..|..|.|.|.|:.:||::..||    |..:.|.....:|  
  Fly   289 VLKEREIIEEVSTFIFTGHDPIAAAISFTLYTLSRHSEIQQKAAEE----QRRIFGENFAGEADL 349

  Fly   351 --AQEMTYMDMVISESLRKWTLSAAADRLCAKDYTLTDDEGTKLFEFKAGDNINIPICGLHWDER 413
              ..:|.|::::|.|:||   |..:...:...:....|..|||:.:.   ..:.:.:..:.::|:
  Fly   350 ARLDQMHYLELIIRETLR---LYPSVPLIARTNRNPIDINGTKVAKC---TTVIMCLIAMGYNEK 408

  Fly   414 FFPQPQRFDPERF-SERRKKDLIPYTYLPFGVGPRSCIGNRYAVMQAKGMLYNLMLNYKI 472
            :|..|..|.|||| :......:..:..:||..|||.||..::|:.|.|.:|..|:..::|
  Fly   409 YFDDPCTFRPERFENPTGNVGIEAFKSVPFSAGPRRCIAEKFAMYQMKALLSQLLRRFEI 468

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp9b1NP_523645.1 p450 37..478 CDD:299894 100/472 (21%)
Cyp4ad1NP_610380.1 p450 36..470 CDD:278495 101/480 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100014
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.