DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp9b1 and Cyp4s3

DIOPT Version :9

Sequence 1:NP_523645.1 Gene:Cyp9b1 / 35634 FlyBaseID:FBgn0015038 Length:505 Species:Drosophila melanogaster
Sequence 2:NP_573003.2 Gene:Cyp4s3 / 32444 FlyBaseID:FBgn0030615 Length:495 Species:Drosophila melanogaster


Alignment Length:508 Identity:118/508 - (23%)
Similarity:213/508 - (41%) Gaps:96/508 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 LATIGLLLF-KWSTGTFKAFEGRNLYFEK--------PYPFLGNMAASALQKASFQKQISEFYNR 65
            ::|:.|:.| .|:  .|..:..:.|.|.:        |.|.:|.:.|: ::|......:.|.  |
  Fly     1 MSTLALVAFVLWA--AFLRYLPKILNFLRLQRFAKTLPGPTIGELIAN-VKKGEILNWLKEL--R 60

  Fly    66 TRHHKLVGLFNLRTPMIQINDPQLIKKICVKDFDHFPNHQTL-NIPNERLVNDMLN----VMRDQ 125
            .:|..:..::..:..|:...||:.||::       ..|:|.| ...|..|:...|.    ....:
  Fly    61 EKHGPVFRIWFGKDLMVMFTDPEDIKQL-------LGNNQLLTKSRNYELLEPWLGKGLLTNGGE 118

  Fly   126 HWRNMRSVLTPVFTSAKMRNMFTLMNESFAQCLEHLKSSQPIAAGENAFELDMKVLCNKLSNDVI 190
            .|...|.:|||.|....:......|.|:....:..|::.   |.||:   .|:.......:.|.|
  Fly   119 SWHRRRKLLTPGFHFRILSEFKEPMEENCRILVRRLRTK---ANGES---FDIYPYITLFALDAI 177

  Fly   191 ATTAFGLKVNSFDDPENEFHTIGKTLAFSRGLPFLKFMMCLLAPKVFNFF-KLTIF--------- 245
            ..||.|:|.::....::|:            :..::.:..::..:.|:|: :|.:|         
  Fly   178 CETAMGIKKHAQLQSDSEY------------VQAVQSICRVMHKQSFSFWQRLNVFFKHTKPGKE 230

  Fly   246 ---------DSTNVEYFVRLVVDAMQYREKHNITRPD-------------MIQLLMEAKKESKDN 288
                     |.||  ..:||..:  |..::.|..:|:             .:.:|:..:.|....
  Fly   231 REAALKVLHDETN--RVIRLRRE--QLIQERNEWKPEAEQDDVGAKRRLAFLDMLLLTQMEGGAE 291

  Fly   289 WTDDEIVAQCFIFFFAAFENNSNLICTTAYELLRNLDIQERLYEEVKETQEALKGAPLTYDAAQE 353
            .:|.:|..:...|.|...:..|:.|......|.:|.|:|:|.:||..|.:...|         :.
  Fly   292 LSDTDIREEVDTFMFEGHDTTSSAIAFALSLLSKNPDVQQRAFEEASELEGREK---------ES 347

  Fly   354 MTYMDMVISESLRKWTLSAAADRLCAKDYTLTDDEGTKLFEFKAGDNINIPICGLHWDERFFPQP 418
            |.|::.||.|:||.:.......|     ..|.|.|..||...| |.:|:..|..||.|.:.||.|
  Fly   348 MPYLEAVIKETLRIYPSVPFFSR-----KVLEDLEVGKLTVPK-GASISCLIYMLHRDPKNFPDP 406

  Fly   419 QRFDPERFSERRKKDLIPYTYLPFGVGPRSCIGNRYAVMQAKGMLYNLMLNYK 471
            :||||:||.. .:|.:.|:.:..|..|||:|||.::|:::.|..|..|:.:|:
  Fly   407 ERFDPDRFLV-NEKQMHPFAFAAFSAGPRNCIGQKFAMLELKTSLAMLLRSYR 458

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp9b1NP_523645.1 p450 37..478 CDD:299894 111/480 (23%)
Cyp4s3NP_573003.2 p450 35..469 CDD:278495 111/472 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100014
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.