DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp9b1 and Cyp4f39

DIOPT Version :9

Sequence 1:NP_523645.1 Gene:Cyp9b1 / 35634 FlyBaseID:FBgn0015038 Length:505 Species:Drosophila melanogaster
Sequence 2:NP_796281.1 Gene:Cyp4f39 / 320997 MGIID:2445210 Length:532 Species:Mus musculus


Alignment Length:548 Identity:113/548 - (20%)
Similarity:204/548 - (37%) Gaps:104/548 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 ICLVLATIGLLLFKWSTGTFKAFEGRNLYFEK----PYP-----FLGNMAASALQKASFQ--KQI 59
            :..:|..:....|:.....||.|....:...|    |.|     .||:|:.....:...|  |::
Mouse    24 VSALLLLVLFFFFRLLVRAFKLFSDFRITCRKLSCFPEPPGRHWLLGHMSMYLPNEKGLQNEKKV 88

  Fly    60 SEFYNRTRHHKLVGLFNLRTPMIQINDPQLIKKICVKDFDHFPNHQTLNIPNERLVNDMLNVMRD 124
            .:    |.||.::.......|::.:..|..||.:........|..:......:..:.|.|.:.:.
Mouse    89 LD----TMHHIILAWVGPFLPLLVLVHPDYIKPVLGASAAIAPKDEFFYSFLKPWLGDGLLISKG 149

  Fly   125 QHWRNMRSVLTPVFTSAKMRNMFTLMNESFAQC--LEHLKSSQPIAAGENAFELDMKVLCNKLSN 187
            ..|...|.:|||.|....::....:.|    ||  :.|.|..:.:|.| :....||....:.::.
Mouse   150 NKWSRHRRLLTPAFHFDILKPYMKIFN----QCTNIMHAKWRRHLAEG-SVTSFDMFEHISLMTL 209

  Fly   188 DVIATTAFGLKVNSFDDPENEFHTIGKTLAFSRGLPFLKFMMCLLAPKVFNFFKLTIFDSTNVEY 252
            |.:....|     |::....|           |...::..::.|.|..|...::|..:    :::
Mouse   210 DSLQKCVF-----SYNSDCQE-----------RMSDYISSIIELSALVVRRQYRLHHY----LDF 254

  Fly   253 FVRLVVDAMQYREK----HNITRP--------------------------DMIQLLMEAKKESKD 287
            ...|..|..::|:.    ||.|..                          |.|.:|:.||.|...
Mouse   255 MYYLTADGRRFRQACDTVHNFTTEVIQERRQALRQQGAEAWLKAKQGKTLDFIDVLLLAKDEEGK 319

  Fly   288 NWTDDEIVAQCFIFFFAAFENNSNLICTTAYELLRNLDIQERLYEEVKETQEALKGAPLTYDAAQ 352
            ..:|::|.|:...|.|...:..|:.:....:.|.:..:.||:..||::|..:..:...|.:|...
Mouse   320 ELSDEDIRAEADTFMFEGHDTTSSGLSWALFNLAKYPEYQEKCREEIQEVMKGRELEELDWDDLT 384

  Fly   353 EMTYMDMVISESLRKWTLSAAADRLCAKDYTLTDDEGTKLFEFKAGDNINIPICGLH-----WDE 412
            ::.:..|.|.||||::.......|.|.:|..|.|..     ....|....:.|.|.|     |.:
Mouse   385 QLPFTTMCIKESLRQFPPVTLISRRCTEDIKLPDGR-----VIPKGIICLVSIYGTHHNPIVWPD 444

  Fly   413 RFFPQPQRFDPERFSERRKKDLIPYTYLPFGVGPRSCIGNRYAVMQAKGMLYNLMLNY------- 470
            .....|.||||:...:|.     |..::||..|||:|||..:|:.:.:.::...:|.:       
Mouse   445 SKVYNPYRFDPDTPQQRS-----PLAFVPFSAGPRNCIGQSFAMAEMRVVVALTLLRFRLSVDRT 504

  Fly   471 -KIEASP----RTTRDMWESARGFNIIP 493
             |:...|    ||...:|     .|:.|
Mouse   505 HKVRRKPELILRTENGLW-----LNVEP 527

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp9b1NP_523645.1 p450 37..478 CDD:299894 103/500 (21%)
Cyp4f39NP_796281.1 p450 60..515 CDD:365848 102/493 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100014
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.