DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp9b1 and Cyp4f5

DIOPT Version :9

Sequence 1:NP_523645.1 Gene:Cyp9b1 / 35634 FlyBaseID:FBgn0015038 Length:505 Species:Drosophila melanogaster
Sequence 2:NP_775147.1 Gene:Cyp4f5 / 286905 RGDID:708364 Length:526 Species:Rattus norvegicus


Alignment Length:448 Identity:101/448 - (22%)
Similarity:178/448 - (39%) Gaps:52/448 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    80 PMIQINDPQLIKKICVKDFDHFPNHQTLNIPNERLVNDMLNVMRDQHWRNMRSVLTPVFTSAKMR 144
            |::::.||..:..:........|...|.....:..:.|.|.:.....|...|.:|||.|....::
  Rat    97 PVLRLVDPAFVAPLLQAPALVAPKDTTFLRFLKPWLGDGLFLSSGDKWSRHRRLLTPAFHFDILK 161

  Fly   145 NMFTLMNESFAQCLEHLKSSQPIAAGENAFELDMKVLCNKLSNDVIATTAFGLKVNSFDDPENEF 209
            ....:.|:|..  :.|.|.......|....|:...:  :.::.|.:....||...|..:.|....
  Rat   162 PYVKIFNQSVN--IMHAKWKHLCLEGSARLEMFENI--SLMTLDSLQKCLFGFDSNCQESPSEYI 222

  Fly   210 HTIGK--TLAFSRG------LPFLKF---------MMCLLAPKVFNFFKLTI------FDSTNVE 251
            ..|.:  :|...|.      |.||.:         ..|.|   |.||....|      ..|...:
  Rat   223 SAILELSSLIIKRSQQLFLYLDFLYYRTADGRRFRKACDL---VHNFTDAVIRERRRLLSSQGTD 284

  Fly   252 YFVRLVVDAMQYREKHNITRPDMIQLLMEAKKESKDNWTDDEIVAQCFIFFFAAFENNSNLICTT 316
            .|       ::.:.|......|.|.:|:.||.|.....:|::|.|:...|.|...:..::.:...
  Rat   285 EF-------LESKTKSKSKTLDFIDVLLLAKDEHGKELSDEDIRAEADTFMFGGHDTTASALSWI 342

  Fly   317 AYELLRNLDIQERLYEEVKETQEALKGAPLTYDAAQEMTYMDMVISESLRKWTLSAAADRLCAKD 381
            .|.|.|:.:.|||..:||.|.....:...:.:|...::.::.|.|.||||....:....|.|.:|
  Rat   343 LYNLARHPEYQERCRQEVWELLRDREPEEIEWDDLAQLPFLTMCIKESLRLHPPAIDLLRRCTQD 407

  Fly   382 YTLTDDEGTKLFEFKAGDNINIPICGLHWDERFFPQPQRFDPERFSERRKKDLIPYTYLPFGVGP 446
            ..|.|..     ....|:...|.|.|:|.:...:|.|:.|||.||....::...|.:::||..||
  Rat   408 IVLPDGR-----VIPKGNICVISIFGIHHNPSVWPDPEVFDPFRFDSENRQKRSPLSFIPFSAGP 467

  Fly   447 RSCIGNRYAVMQAKGMLYNLMLNYKI---EASPRTTRDMWESARGFNIIPTTGFWMQL 501
            |:|||..:|:.:.|.::...:|.:::   :..||...::...|.|       |.|:::
  Rat   468 RNCIGQTFAMNEMKVVVALTLLRFRVLPDDKEPRRKPEIILRAEG-------GLWLRM 518

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp9b1NP_523645.1 p450 37..478 CDD:299894 96/423 (23%)
Cyp4f5NP_775147.1 p450 52..516 CDD:278495 100/444 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100014
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.