DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp9b1 and CYP4V2

DIOPT Version :9

Sequence 1:NP_523645.1 Gene:Cyp9b1 / 35634 FlyBaseID:FBgn0015038 Length:505 Species:Drosophila melanogaster
Sequence 2:NP_997235.3 Gene:CYP4V2 / 285440 HGNCID:23198 Length:525 Species:Homo sapiens


Alignment Length:546 Identity:118/546 - (21%)
Similarity:223/546 - (40%) Gaps:85/546 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 IGLL---LFKWSTGTFKAFEGRNLYFE----------------------KPYPFLGNMAASALQK 52
            :||:   |..|...:..:..|.:|...                      :.||.:|:........
Human     6 LGLVWQKLLLWGAASALSLAGASLVLSLLQRVASYARKWQQMRPIPTVARAYPLVGHALLMKPDG 70

  Fly    53 ASFQKQISEFYNRTRHHKLVGLFNLRTPMIQINDPQLIKKICV--KDFDHFPNHQTLNIPNERLV 115
            ..|.:||.|:....||..|:.|:....||:.:.:.:.::.|..  |..|....::.|    |..:
Human    71 REFFQQIIEYTEEYRHMPLLKLWVGPVPMVALYNAENVEVILTSSKQIDKSSMYKFL----EPWL 131

  Fly   116 NDMLNVMRDQHWRNMRSVLTPVFTSAKMRNMFTLMNESFAQCLEHLKSSQPIAAGENAFELDMKV 180
            ...|.......||:.|.:|||.|....:.:...:|||.....::.|:..    ..:.||.....:
Human   132 GLGLLTSTGNKWRSRRKMLTPTFHFTILEDFLDIMNEQANILVKKLEKH----INQEAFNCFFYI 192

  Fly   181 -LCNKLSNDVIATTAFGLKVNSFDDPENEF----HTIGKTLAFSRGLPFLKFMMCLLAPKVFNFF 240
             ||   :.|:|..||.|..:.:..:.::|:    :.:.:.:.....:|:|...:..|      .|
Human   193 TLC---ALDIICETAMGKNIGAQSNDDSEYVRAVYRMSEMIFRRIKMPWLWLDLWYL------MF 248

  Fly   241 K--------LTIFDS-TNVEYFVRLVVDAMQYREKHNITRPD-------------MIQLLMEAKK 283
            |        |.|..: ||     .::.:.......:...|.|             .:.||:....
Human   249 KEGWEHKKSLQILHTFTN-----SVIAERANEMNANEDCRGDGRGSAPSKNKRRAFLDLLLSVTD 308

  Fly   284 ESKDNWTDDEIVAQCFIFFFAAFENNSNLICTTAYELLRNLDIQERLYEEVKETQEALKGAPLTY 348
            :..:..:.::|..:...|.|...:..:..|..:.|.|..|.::|:::..|:.:. ......|.|.
Human   309 DEGNRLSHEDIREEVDTFMFEGHDTTAAAINWSLYLLGSNPEVQKKVDHELDDV-FGKSDRPATV 372

  Fly   349 DAAQEMTYMDMVISESLRKWTLSAAADRLCAKDYTLTDDEGTKLFEFKAGDNINIPICGLHWDER 413
            :..:::.|::.||.|:||.:.......|..::|..:.   |.::  .|..:.:.||. .||.|.|
Human   373 EDLKKLRYLECVIKETLRLFPSVPLFARSVSEDCEVA---GYRV--LKGTEAVIIPY-ALHRDPR 431

  Fly   414 FFPQPQRFDPERFSERRKKDLIPYTYLPFGVGPRSCIGNRYAVMQAKGMLYNLMLNYKIEASPRT 478
            :||.|:.|.||||.....:...||.|:||..|||:|||.::|||:.|.:|..::.::.||::.: 
Human   432 YFPNPEEFQPERFFPENAQGRHPYAYVPFSAGPRNCIGQKFAVMEEKTILSCILRHFWIESNQK- 495

  Fly   479 TRDMWESARGFNIIPTTGFWMQLVSR 504
             |:.........:.|:.|.|::|..|
Human   496 -REELGLEGQLILRPSNGIWIKLKRR 520

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp9b1NP_523645.1 p450 37..478 CDD:299894 106/469 (23%)
CYP4V2NP_997235.3 p450 55..517 CDD:278495 110/492 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100014
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.