DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp9b1 and CYP4A22

DIOPT Version :9

Sequence 1:NP_523645.1 Gene:Cyp9b1 / 35634 FlyBaseID:FBgn0015038 Length:505 Species:Drosophila melanogaster
Sequence 2:NP_001010969.2 Gene:CYP4A22 / 284541 HGNCID:20575 Length:519 Species:Homo sapiens


Alignment Length:428 Identity:99/428 - (23%)
Similarity:169/428 - (39%) Gaps:73/428 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    82 IQINDPQLIKKICVKDFDHFPNHQTLNIPNERLVNDMLNVMRDQHWRNMRSVLTPVFTSAKMRNM 146
            :|:.||..:|.|..:...  .:|.:......|:...:| ::..|.|...|.:|||.|.:..::..
Human    97 VQLYDPDYMKVILGRSDP--KSHGSYKFLAPRIGYGLL-LLNGQTWFQHRRMLTPAFHNDILKPY 158

  Fly   147 FTLMNESFAQCL----EHLKSSQPIAAGENAFELDMKVLCNKLSNDVIATTAFGLK--------- 198
            ..||.:|....|    |.|....|:...::.         :.::.|.|..:||..:         
Human   159 VGLMADSVRVMLDKWEELLGQDSPLEVFQHV---------SLMTLDTIMKSAFSHQGSIQVDRNS 214

  Fly   199 ---------VNS--FDDPENEFH---TIGKTLAFSRGLPFLKFMMCLLA----PKVFNFFKLTIF 245
                     :||  |....|.||   ||....:..|    .....|.||    .:|....|..:.
Human   215 QSYIQAISDLNSLVFCCMRNAFHENDTIYSLTSAGR----WTHRACQLAHQHTDQVIQLRKAQLQ 275

  Fly   246 DSTNVEYFVRLVVDAMQYREKHNITRPDMIQLLMEAKKESKDNWTDDEIVAQCFIFFFAAFENNS 310
            ....:|          :.:.|.::   |.:.:|:.||.|:....:|.::.|:...|.|...:..:
Human   276 KEGELE----------KIKRKRHL---DFLDILLLAKMENGSILSDKDLRAEVDTFMFEGHDTTA 327

  Fly   311 NLICTTAYELLRNLDIQERLYEEVKETQEAL--KGAPLTYDAAQEMTYMDMVISESLRKWTLSAA 373
            :.|....|.|..:...|||..||:    ..|  .||.:|::...:|.|..|.|.|:||.:.....
Human   328 SGISWILYALATHPKHQERCREEI----HGLLGDGASITWNHLDQMPYTTMCIKEALRLYPPVPG 388

  Fly   374 ADRLCAKDYTLTDDEGTKLFEFKAGDNINIPICGLHWDERFFPQPQRFDPERFSERRKKDLIPYT 438
            ..|..:...|..|  |..|   ..|..:.:.|.|||.:.:.:|..:.|||.||:....:.  .:.
Human   389 IGRELSTPVTFPD--GRSL---PKGIMVLLSIYGLHHNPKVWPNLEVFDPSRFAPGSAQH--SHA 446

  Fly   439 YLPFGVGPRSCIGNRYAVMQAKGMLYNLMLNYKIEASP 476
            :|||..|.|:|||.::|:.|.|......:|.:::...|
Human   447 FLPFSGGSRNCIGKQFAMNQLKVARALTLLRFELLPDP 484

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp9b1NP_523645.1 p450 37..478 CDD:299894 99/428 (23%)
CYP4A22NP_001010969.2 p450 52..505 CDD:278495 99/428 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100014
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.