DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp9b1 and CYP4X1

DIOPT Version :9

Sequence 1:NP_523645.1 Gene:Cyp9b1 / 35634 FlyBaseID:FBgn0015038 Length:505 Species:Drosophila melanogaster
Sequence 2:NP_828847.1 Gene:CYP4X1 / 260293 HGNCID:20244 Length:509 Species:Homo sapiens


Alignment Length:537 Identity:135/537 - (25%)
Similarity:224/537 - (41%) Gaps:85/537 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSFVEICLVLATIGLLLFKWSTGTFKAFEGRNLYFE--------KPYP------FLGNMAASALQ 51
            ::|| .||.|   |||            :...||..        :|:|      |||:.  ..:|
Human    16 LAFV-FCLAL---GLL------------QAIKLYLRRQRLLRDLRPFPAPPTHWFLGHQ--KFIQ 62

  Fly    52 KASFQK--QISEFYNRTRHHKLVGLFNLRTPMIQINDPQLIKKICVKDFDHFPNHQTLNIPNERL 114
            ..:.:|  :|.|.|.|. ....:|.|.   ....|.||...|.:..:.   .|..|.|...:..|
Human    63 DDNMEKLEEIIEKYPRA-FPFWIGPFQ---AFFCIYDPDYAKTLLSRT---DPKSQYLQKFSPPL 120

  Fly   115 VNDMLNVMRDQHWRNMRSVLTPVFTSAKMRNMFTLMNESFAQCL---EHLKSSQPIAAGENAFEL 176
            :...|..:....|...|.:|||.|....::....:|..|....|   |.:.|:|     :.:.|:
Human   121 LGKGLAALDGPKWFQHRRLLTPGFHFNILKAYIEVMAHSVKMMLDKWEKICSTQ-----DTSVEV 180

  Fly   177 DMKVLCNKLSNDVIATTAF----GLKVNSFDDPENE---------FHTIGKTLAFSRGLPFLKFM 228
            ...:  |.:|.|:|...||    ..:.||..||..:         ||.:...|..|.       :
Human   181 YEHI--NSMSLDIIMKCAFSKETNCQTNSTHDPYAKAIFELSKIIFHRLYSLLYHSD-------I 236

  Fly   229 MCLLAPKVFNFFKLTIFDSTNVEYFVRLVVDAMQYREKHNIT----RPDMIQLLMEAKKESKDNW 289
            :..|:|:.:.|.||:...:...:..::....::|...|.:.|    ..|.:.:::.||.||..::
Human   237 IFKLSPQGYRFQKLSRVLNQYTDTIIQERKKSLQAGVKQDNTPKRKYQDFLDIVLSAKDESGSSF 301

  Fly   290 TDDEIVAQCFIFFFAAFENNSNLICTTAYELLRNLDIQERLYEEVKETQEALKGAPLTYDAAQEM 354
            :|.::.::...|..|..:..:..|....|.|..|.:.|||..|||:....  .|:.:|:|...||
Human   302 SDIDVHSEVSTFLLAGHDTLAASISWILYCLALNPEHQERCREEVRGILG--DGSSITWDQLGEM 364

  Fly   355 TYMDMVISESLRKWTLSAAADRLCAKDYTLTDDEGTKLFEFKAGDNINIPICGLHWDERFFPQPQ 419
            :|..|.|.|:.|......:..|..:|..|..|  |..|   .||..:.:.|.|||.:...:..|:
Human   365 SYTTMCIKETCRLIPAVPSISRDLSKPLTFPD--GCTL---PAGITVVLSIWGLHHNPAVWKNPK 424

  Fly   420 RFDPERFSERRKKDLIPYTYLPFGVGPRSCIGNRYAVMQAKGMLYNLMLNYKIEASPRTTRDMWE 484
            .|||.|||:.......||.||||..|.|:|||..:|:::.|..:..::|::::  :|..||.: .
Human   425 VFDPLRFSQENSDQRHPYAYLPFSAGSRNCIGQEFAMIELKVTIALILLHFRV--TPDPTRPL-T 486

  Fly   485 SARGFNIIPTTGFWMQL 501
            ....|.:.|..|.::.|
Human   487 FPNHFILKPKNGMYLHL 503

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp9b1NP_523645.1 p450 37..478 CDD:299894 119/468 (25%)
CYP4X1NP_828847.1 p450 47..501 CDD:306555 123/486 (25%)
heme binding region 447..460 6/12 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100014
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.