DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp9b1 and cyp-25A6

DIOPT Version :9

Sequence 1:NP_523645.1 Gene:Cyp9b1 / 35634 FlyBaseID:FBgn0015038 Length:505 Species:Drosophila melanogaster
Sequence 2:NP_001360017.1 Gene:cyp-25A6 / 187059 WormBaseID:WBGene00019438 Length:235 Species:Caenorhabditis elegans


Alignment Length:180 Identity:44/180 - (24%)
Similarity:85/180 - (47%) Gaps:13/180 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 KPYPFLGNMAASALQKASFQKQIS-EFYNRTRHHK----LVGLFNLRTPMIQINDPQLIKKICVK 96
            :|:..:||:.....:||......| ::||:.  ||    ..|::......|.|.:.:.||::.:|
 Worm    40 EPHWLMGNLKQIIERKAKLGYDDSYDWYNKL--HKQFGETFGIYFGTQLNINITNEEDIKEVFIK 102

  Fly    97 DFDHFPNHQTLN-IPNERLVNDMLNVMRDQHWRNMRSVLTPVFTSAKMRNMFTLMNESFAQCLEH 160
            :|.:|.:..... |.:.:|...:|....:..|::.||.:.|:|::.||:.|...::......||.
 Worm   103 NFSNFSDRTPPPIIEDNKLKESLLQNTYESGWKHTRSAIAPIFSTGKMKAMHETIHSKVDLFLEI 167

  Fly   161 LKSSQPIAAGENAFELDMKVLCNKLSNDVIATTAFGLKVNSFDDPENEFH 210
            ||  :..::|:   :.|:......|:.|||...||.:..|...|..:.|:
 Worm   168 LK--EKASSGQ---KWDIYDDFQGLTLDVIGKCAFAIDSNCQRDRNDIFY 212

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp9b1NP_523645.1 p450 37..478 CDD:299894 44/180 (24%)
cyp-25A6NP_001360017.1 p450 37..>215 CDD:386267 44/180 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160166575
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0158
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D264519at33208
OrthoFinder 1 1.000 - - FOG0000037
OrthoInspector 1 1.000 - - mtm4722
orthoMCL 1 0.900 - - OOG6_100014
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.740

Return to query results.
Submit another query.