DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp9b1 and cyp-29A2

DIOPT Version :9

Sequence 1:NP_523645.1 Gene:Cyp9b1 / 35634 FlyBaseID:FBgn0015038 Length:505 Species:Drosophila melanogaster
Sequence 2:NP_505847.1 Gene:cyp-29A2 / 179550 WormBaseID:WBGene00011830 Length:503 Species:Caenorhabditis elegans


Alignment Length:395 Identity:97/395 - (24%)
Similarity:185/395 - (46%) Gaps:37/395 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   125 QHWRNMRSVLTPVFTSAKMRNMFTLMNESFAQCLEHLKSSQPIAAGENAFELDMKVLCNKLSNDV 189
            :.|::.|.:|||.|..||:...|.:.|......::.|  |...|:||.   :|:.....:.:.|:
 Worm   130 ERWKSHRKMLTPAFHFAKLGGYFEVFNNESKILIDLL--SDFSASGET---VDIFPYVKRCALDI 189

  Fly   190 IATTAFGLKVNSFDDPENE-------FHTIGKTLAFSRGLPFLK--FMMCLLAPKV-FNFFKLTI 244
            |:.||.|:|:::..:.:::       ::.||..::|:   |.||  |:......|. ::.:..|:
 Worm   190 ISETAMGIKIDAQINHDHKYVQAVEGYNKIGVLVSFN---PHLKNQFIFWATGYKAQYDDYLSTL 251

  Fly   245 FDSTNVEYFV---RLVVDAMQYREKHNITRPDMIQLLMEAKKESKDNWTDDEIVAQCFIFFFAAF 306
            ...|  |..:   |...|:.:..::.:....:.:.|::  ..|..:..|.::|..:...|.||..
 Worm   252 KSMT--EKVIKERRAAHDSGEVEKETSKRMMNFLDLML--SMEESNQLTSEDIRQEVDTFMFAGH 312

  Fly   307 ENNSNLICTTAYELLRNLDIQERLYEEVKETQEALKGAPLTYDAAQEMTYMDMVISESLRKWTLS 371
            :..::......:.|..|.::||::|:|:.|.........:|.:....:.|:|:|:.||.|   :.
 Worm   313 DTTTSSTSWACWNLAHNPNVQEKVYKEMIEVFGDDPNTDITLENVNNLNYLDIVLKESKR---II 374

  Fly   372 AAADRLCAKDYTLTDDEGTKLFEFKAGDNINIPICGLHWDERFFPQPQRFDPERFSERRKKDLIP 436
            |....|..|   ||:|.....:...||.|:.|....||.:...|..|..|:|:||.........|
 Worm   375 APVPALQRK---LTNDLEIDGYIVPAGGNVTISPMVLHSNHHVFKNPTEFNPDRFLPDEVSKRHP 436

  Fly   437 YTYLPFGVGPRSCIGNRYAVMQAKGMLYNLMLNYKIEASPR--TTRDMWESARGFNIIPTTGFWM 499
            |.::||..|||:|||.::|.:..|.|:.:::.|:|||.:.:  .|:...|....    |:.|..:
 Worm   437 YDFMPFLAGPRNCIGQKFAQLNEKVMISHIVRNFKIEPTLKYNDTKPCLEVVTK----PSNGIPV 497

  Fly   500 QLVSR 504
            :|:.|
 Worm   498 RLIRR 502

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp9b1NP_523645.1 p450 37..478 CDD:299894 91/367 (25%)
cyp-29A2NP_505847.1 p450 37..495 CDD:278495 94/386 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100014
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.