DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp9b1 and CYP4A11

DIOPT Version :9

Sequence 1:NP_523645.1 Gene:Cyp9b1 / 35634 FlyBaseID:FBgn0015038 Length:505 Species:Drosophila melanogaster
Sequence 2:NP_000769.2 Gene:CYP4A11 / 1579 HGNCID:2642 Length:519 Species:Homo sapiens


Alignment Length:464 Identity:105/464 - (22%)
Similarity:173/464 - (37%) Gaps:88/464 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    50 LQKASFQKQISEFYNRTRHHKLVGLFNLRTPMIQINDPQLIKKICVKDFDHFPNHQTLNIPNERL 114
            ||:  .||.:..|.:...|....|...     :|:.||..:|.|..:.............|   .
Human    72 LQR--IQKWVETFPSACPHWLWGGKVR-----VQLYDPDYMKVILGRSDPKSHGSYRFLAP---W 126

  Fly   115 VNDMLNVMRDQHWRNMRSVLTPVFTSAKMRNMFTLMNESFAQCL----EHLKSSQPIAAGENAFE 175
            :...|.::..|.|...|.:|||.|....::....||.:|....|    |.|....|:...::.  
Human   127 IGYGLLLLNGQTWFQHRRMLTPAFHYDILKPYVGLMADSVRVMLDKWEELLGQDSPLEVFQHV-- 189

  Fly   176 LDMKVLCNKLSNDVIATTAFGLK------------VNSFDDPENEFHTIGKTLAFSRGLPFLKFM 228
                   :.::.|.|...||..:            :.:..|..|        |.|||        
Human   190 -------SLMTLDTIMKCAFSHQGSIQVDRNSQSYIQAISDLNN--------LVFSR-------- 231

  Fly   229 MCLLAPKVFNFFKL--TIFDST---------------NVEYFVRLVVDAMQYR-EKHNITRP--- 272
                   |.|.|..  ||:..|               :.:..::|....:|.. |...|.|.   
Human   232 -------VRNAFHQNDTIYSLTSAGRWTHRACQLAHQHTDQVIQLRKAQLQKEGELEKIKRKRHL 289

  Fly   273 DMIQLLMEAKKESKDNWTDDEIVAQCFIFFFAAFENNSNLICTTAYELLRNLDIQERLYEEVKET 337
            |.:.:|:.||.|:....:|.::.|:...|.|...:..::.|....|.|..:...|||..||:...
Human   290 DFLDILLLAKMENGSILSDKDLRAEVDTFMFEGHDTTASGISWILYALATHPKHQERCREEIHSL 354

  Fly   338 QEALKGAPLTYDAAQEMTYMDMVISESLRKWTLSAAADRLCAKDYTLTDDEGTKLFEFKAGDNIN 402
            ..  .||.:|::...:|.|..|.|.|:||.:.......|..:...|..|  |..|   ..|..:.
Human   355 LG--DGASITWNHLDQMPYTTMCIKEALRLYPPVPGIGRELSTPVTFPD--GRSL---PKGIMVL 412

  Fly   403 IPICGLHWDERFFPQPQRFDPERFSERRKKDLIPYTYLPFGVGPRSCIGNRYAVMQAKGMLYNLM 467
            :.|.|||.:.:.:|.|:.|||.||:....:.  .:.:|||..|.|:|||.::|:.:.|......:
Human   413 LSIYGLHHNPKVWPNPEVFDPFRFAPGSAQH--SHAFLPFSGGSRNCIGKQFAMNELKVATALTL 475

  Fly   468 LNYKIEASP 476
            |.:::...|
Human   476 LRFELLPDP 484

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp9b1NP_523645.1 p450 37..478 CDD:299894 105/464 (23%)
CYP4A11NP_000769.2 p450 52..505 CDD:278495 105/464 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100014
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.