DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp9b1 and CYP3A4

DIOPT Version :9

Sequence 1:NP_523645.1 Gene:Cyp9b1 / 35634 FlyBaseID:FBgn0015038 Length:505 Species:Drosophila melanogaster
Sequence 2:NP_059488.2 Gene:CYP3A4 / 1576 HGNCID:2637 Length:503 Species:Homo sapiens


Alignment Length:497 Identity:141/497 - (28%)
Similarity:255/497 - (51%) Gaps:56/497 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 VEICLVLATIGLLLFKWSTGTFKAFEGRNLYFEKPYPFLGNMAASALQKASFQKQISEFYNRTRH 68
            :|..|:||...:||:.:.|.:...|:...:....|.|||||:.:.......|..:..:.|.    
Human     9 METWLLLAVSLVLLYLYGTHSHGLFKKLGIPGPTPLPFLGNILSYHKGFCMFDMECHKKYG---- 69

  Fly    69 HKLVGLFNLRTPMIQINDPQLIKKICVKD-FDHFPNHQTLNIPNERLVNDMLNVMRDQHWRNMRS 132
             |:.|.::.:.|::.|.||.:||.:.||: :..|.|.:......  .:...:::..|:.|:.:||
Human    70 -KVWGFYDGQQPVLAITDPDMIKTVLVKECYSVFTNRRPFGPVG--FMKSAISIAEDEEWKRLRS 131

  Fly   133 VLTPVFTSAKMRNMFTLMNESFAQCLEHLKSSQPIAAGENAFELDMKVLCNKLSNDVIATTAFGL 197
            :|:|.|||.|::.|..::.:.....:.:|:..     .|....:.:|.:....|.|||.:|:||:
Human   132 LLSPTFTSGKLKEMVPIIAQYGDVLVRNLRRE-----AETGKPVTLKDVFGAYSMDVITSTSFGV 191

  Fly   198 KVNSFDDPENEFHTIGKTL--------------AFSRGLPFLKFM-MCLLAPKVFNFFKLTIFDS 247
            .::|.::|::.|....|.|              .|...:|.|:.: :|:...:|.||.:.::   
Human   192 NIDSLNNPQDPFVENTKKLLRFDFLDPFFLSITVFPFLIPILEVLNICVFPREVTNFLRKSV--- 253

  Fly   248 TNVEYFVRLVVDAMQYREKHNITRPDMIQLLMEAKK----ESKDNWTDDEIVAQCFIFFFAAFEN 308
                  .|:....::..:||   |.|.:||:::::.    ||....:|.|:|||..||.||.:|.
Human   254 ------KRMKESRLEDTQKH---RVDFLQLMIDSQNSKETESHKALSDLELVAQSIIFIFAGYET 309

  Fly   309 NSNLICTTAYELLRNLDIQERLYEEVKETQEAL--KGAPLTYDAAQEMTYMDMVISESLRKWTLS 371
            .|:::....|||..:.|:|::|.||:    :|:  ..||.|||...:|.|:|||::|:||.:.::
Human   310 TSSVLSFIMYELATHPDVQQKLQEEI----DAVLPNKAPPTYDTVLQMEYLDMVVNETLRLFPIA 370

  Fly   372 AAADRLCAKDYTLTDDEGTKLFEFKAGDNINIPICGLHWDERFFPQPQRFDPERFSERRKKDLIP 436
            ...:|:|.||..:..     :| ...|..:.||...||.|.:::.:|::|.|||||::.|.::.|
Human   371 MRLERVCKKDVEING-----MF-IPKGVVVMIPSYALHRDPKYWTEPEKFLPERFSKKNKDNIDP 429

  Fly   437 YTYLPFGVGPRSCIGNRYAVMQAKGMLYNLMLNYKIEASPRT 478
            |.|.|||.|||:|||.|:|:|..|..|..::.|:..:....|
Human   430 YIYTPFGSGPRNCIGMRFALMNMKLALIRVLQNFSFKPCKET 471

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp9b1NP_523645.1 p450 37..478 CDD:299894 132/462 (29%)
CYP3A4NP_059488.2 p450 39..493 CDD:365848 133/467 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 262 1.000 Domainoid score I1946
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 277 1.000 Inparanoid score I2940
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D264519at33208
OrthoFinder 1 1.000 - - FOG0000037
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100014
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X40
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
87.870

Return to query results.
Submit another query.