DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp9b1 and Cyp4b1

DIOPT Version :9

Sequence 1:NP_523645.1 Gene:Cyp9b1 / 35634 FlyBaseID:FBgn0015038 Length:505 Species:Drosophila melanogaster
Sequence 2:NP_031849.1 Gene:Cyp4b1 / 13120 MGIID:103225 Length:511 Species:Mus musculus


Alignment Length:381 Identity:87/381 - (22%)
Similarity:161/381 - (42%) Gaps:49/381 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   119 LNVMRDQHWRNMRSVLTPVFTSAKMRNMFTLMNESFAQCLEHLKSSQPIAAGEN-AFELDMKVLC 182
            |.|:....|...|.:|||.|....::....:..||....|:..:..    |.|| :|:    :.|
Mouse   126 LLVLEGPKWFQHRKLLTPGFHYDVLKPYVAIFAESTRVMLDKWEKK----ASENKSFD----IFC 182

  Fly   183 N--KLSNDVIATTAFGLKVNSFDDPENEFH--TIGKTLAFSRGLPFLKF---MMCLLAPKVFNFF 240
            :  .::.|.:....||...:.....:|.::  ....||...:.:...::   .:..|.|....|.
Mouse   183 DVGHMALDTLMKCTFGKGDSGLSHSDNSYYLAVSDLTLLMQQRIDSFQYHNDFIYWLTPHGRRFL 247

  Fly   241 KLTIFDSTNVEYFVRLVVDAMQ-------YREKHNITRPDMIQLLMEAKKESKDNWTDDEIVAQC 298
            :.......:.::.:|....|:|       .:|:.::   |.:.:|:.|:.||....:|.::.|:.
Mouse   248 RACQIAHDHTDHVIRQRKAALQDEKEQKKLQERRHL---DFLDILLGARDESGIKLSDADLRAEV 309

  Fly   299 FIFFFAAFENNSN-----LICTTAYELLRNLDIQERLYEEVKE---TQEALKGAPLTYDAAQEMT 355
            ..|.|...:..::     |.|...|.:     .|:|..|||:|   .:::.:     :|...:||
Mouse   310 DTFMFEGHDTTTSGISWFLYCMALYPM-----HQQRCREEVREILGDRDSFQ-----WDDLAQMT 364

  Fly   356 YMDMVISESLRKWTLSAAADRLCAKDYTLTDDEGTKLFEFKAGDNINIPICGLHWDERFFPQPQR 420
            |:.|.:.|..|.:.......|..:|..|..|  |..|   .||..|::.|..||.:...:|.|:.
Mouse   365 YLTMCMKECFRLYPPVPQVYRQLSKPVTFVD--GRSL---PAGSLISLHIYALHRNSAVWPDPEV 424

  Fly   421 FDPERFSERRKKDLIPYTYLPFGVGPRSCIGNRYAVMQAKGMLYNLMLNYKIEASP 476
            |||.|||........|:.::||..|||:|||.::|:.:.|.:....:|.::....|
Mouse   425 FDPLRFSPENMTGRHPFAFMPFSAGPRNCIGQQFAMNEMKVVTALCLLRFEFSPDP 480

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp9b1NP_523645.1 p450 37..478 CDD:299894 87/381 (23%)
Cyp4b1NP_031849.1 p450 47..500 CDD:278495 87/381 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100014
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.