DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp9b1 and Cyp4a10

DIOPT Version :9

Sequence 1:NP_523645.1 Gene:Cyp9b1 / 35634 FlyBaseID:FBgn0015038 Length:505 Species:Drosophila melanogaster
Sequence 2:NP_034141.3 Gene:Cyp4a10 / 13117 MGIID:88611 Length:509 Species:Mus musculus


Alignment Length:524 Identity:113/524 - (21%)
Similarity:199/524 - (37%) Gaps:133/524 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    45 MAASALQKASFQKQISEFYNRTRHHKLVGLFNLRTPMIQINDPQLIKKICVKDFDHFPN------ 103
            |:.|||....|...:|.|....   .::||..|....:|.   .|.::..:|.|..||:      
Mouse     1 MSVSALSPTRFADSLSGFLQVA---SVLGLLLLLVKAVQF---YLHRQWLLKAFQQFPSPPFHWF 59

  Fly   104 --HQTL--------------NIPNE-----------------------------------RLVND 117
              |:..              |.|:.                                   ||:..
Mouse    60 FGHEKFKGDQELQEIVSCIENFPSAFPRWFWGSKAYLTVYDPDYMKVILGRSDPKANGAYRLLAP 124

  Fly   118 MLN----VMRDQHWRNMRSVLTPVFTSAKMRNMFTLMNESFAQCLEHLKSSQPIAAGENAFELDM 178
            .:.    ::..|.|...|.:|||.|....::.....|.:|....|:   ..:.:|..:::.|:..
Mouse   125 WIGYGLLLLNGQPWFQHRRMLTPAFHYDILKPYVKNMADSIRLMLD---KWERLADQDSSIEIFQ 186

  Fly   179 KVLCNKLSNDVIATTAFGLK------------VNSFDDPENEFH-----------TIGKTLAFSR 220
            .:  :.::.|.:...||..|            :.:..|..|.||           ||.|..:..|
Mouse   187 HI--SLMTLDTVMKCAFSHKGSVQVDGNYRTYLQAIGDLNNLFHSRVRNIFHQNDTIYKLSSNGR 249

  Fly   221 GLPFLKFMMCLLAPKVFNFFKLTIFDSTNVEYFVRLVVDAMQ-------YREKHNITRPDMIQLL 278
                |....|.||           .|.|  :..::|..|.:|       .::|.   |.|.:.:|
Mouse   250 ----LAKQACQLA-----------HDHT--DGVIKLRKDQLQDEGELEKIKKKR---RLDFLDIL 294

  Fly   279 MEAKKESKDNWTDDEIVAQCFIFFFAAFENNSNLICTTAYELLRNLDIQERLYEEVKETQEAL-K 342
            :.|:.|:.|:.:|.::.|:...|.|...:..::.:....|.|..:.|.|:|..|||   |..| .
Mouse   295 LFARMENGDSMSDKDLRAEVDTFMFEGHDTTASGVSWIFYALATHPDHQQRCREEV---QSLLGD 356

  Fly   343 GAPLTYDAAQEMTYMDMVISESLRKWTLSAAADRLCAKDYTLTDDEGTKLFEFKAGDNINIPICG 407
            |:.:|:|...::.|..|.|.|:||.:.......|..:...|..|  |..|   ..|..:.:.|.|
Mouse   357 GSSITWDHLDQIPYTTMCIKEALRLYPPVPGIVRELSTSVTFPD--GRSL---PKGVQVTLSIYG 416

  Fly   408 LHWDERFFPQPQRFDPERFSERRKKDLIPYTYLPFGVGPRSCIGNRYAVMQAKGMLYNLMLNYKI 472
            ||.:.:.:|.|:.|||.||:....:.  .:::|||..|.|:|||.::|:.:.|.::...:|.:::
Mouse   417 LHHNPKVWPNPEVFDPSRFAPDSPRH--SHSFLPFSGGARNCIGKQFAMSELKVIVALTLLRFEL 479

  Fly   473 EASP 476
            ...|
Mouse   480 LPDP 483

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp9b1NP_523645.1 p450 37..478 CDD:299894 113/524 (22%)
Cyp4a10NP_034141.3 p450 52..503 CDD:278495 98/467 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100014
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.