DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp9b1 and CYP4F22

DIOPT Version :9

Sequence 1:NP_523645.1 Gene:Cyp9b1 / 35634 FlyBaseID:FBgn0015038 Length:505 Species:Drosophila melanogaster
Sequence 2:NP_775754.2 Gene:CYP4F22 / 126410 HGNCID:26820 Length:531 Species:Homo sapiens


Alignment Length:492 Identity:102/492 - (20%)
Similarity:185/492 - (37%) Gaps:76/492 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 PYP-----FLGNMAASALQKASFQKQISEFYNRTRHHKLVGLFNLRTPMIQINDPQLIKKICVKD 97
            |.|     .||::......:|..|.:.....|  .||.|:.......|::.:..|..||.:.   
Human    60 PQPPRRNWLLGHLGMYLPNEAGLQDEKKVLDN--MHHVLLVWMGPVLPLLVLVHPDYIKPLL--- 119

  Fly    98 FDHFPNHQTLNIPNERL--------VNDMLNVMRDQHWRNMRSVLTPVFTSAKMRNMFTLMNESF 154
                 .......|.:.|        :.|.|.:.:...|...|.:|||.|....::....:.|:| 
Human   120 -----GASAAIAPKDDLFYGFLKPWLGDGLLLSKGDKWSRHRRLLTPAFHFDILKPYMKIFNQS- 178

  Fly   155 AQCLEHLKSSQPIAAGENAFELDMKVLCNKLSNDVIATTAFGLKVNSFDDPENEFHTIGKTLAFS 219
             ..:.|.| .:.:|.| :|..|||....:.::.|.:....|....|..:...:....|.:..|.|
Human   179 -ADIMHAK-WRHLAEG-SAVSLDMFEHISLMTLDSLQKCVFSYNSNCQEKMSDYISAIIELSALS 240

  Fly   220 RGLPFLKFMMCLLAPKVFNFFKLTIFDSTNVEYFVRLVVDAMQY------REKHNITRP------ 272
            ....:          ::.::.....:.|.:...| |...|.:.:      :|:....|.      
Human   241 VRRQY----------RLHHYLDFIYYRSADGRRF-RQACDMVHHFTTEVIQERRRALRQQGAEAW 294

  Fly   273 ---------DMIQLLMEAKKESKDNWTDDEIVAQCFIFFFAAFENNSNLICTTAYELLRNLDIQE 328
                     |.|.:|:.|:.|.....:|::|.|:...|.|...:..|:.|....:.|.:..:.||
Human   295 LKAKQGKTLDFIDVLLLARDEDGKELSDEDIRAEADTFMFEGHDTTSSGISWMLFNLAKYPEYQE 359

  Fly   329 RLYEEVKETQEALKGAPLTYDAAQEMTYMDMVISESLRKWTLSAAADRLCAKDYTLTDDEGTKLF 393
            :..||::|..:..:...|.:|...::.:..|.|.||||::.......|.|.:|..|.|..     
Human   360 KCREEIQEVMKGRELEELEWDDLTQLPFTTMCIKESLRQYPPVTLVSRQCTEDIKLPDGR----- 419

  Fly   394 EFKAGDNINIPICGLHWDERFFPQPQRFDPERFSERRKKDLIPYTYLPFGVGPRSCIGNRYAVMQ 458
            ....|....:.|.|.|.:...:|..:.::|.||.....:...|..|:||..|||:|||..:|:.:
Human   420 IIPKGIICLVSIYGTHHNPTVWPDSKVYNPYRFDPDNPQQRSPLAYVPFSAGPRNCIGQSFAMAE 484

  Fly   459 AKGMLYNLMLNY--------KIEASP----RTTRDMW 483
            .:.::...:|.:        |:...|    ||...:|
Human   485 LRVVVALTLLRFRLSVDRTRKVRRKPELILRTENGLW 521

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp9b1NP_523645.1 p450 37..478 CDD:299894 99/485 (20%)
CYP4F22NP_775754.2 p450 60..524 CDD:278495 102/492 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100014
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.