DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp9b1 and Cyp4f15

DIOPT Version :9

Sequence 1:NP_523645.1 Gene:Cyp9b1 / 35634 FlyBaseID:FBgn0015038 Length:505 Species:Drosophila melanogaster
Sequence 2:NP_598888.1 Gene:Cyp4f15 / 106648 MGIID:2146921 Length:534 Species:Mus musculus


Alignment Length:555 Identity:125/555 - (22%)
Similarity:212/555 - (38%) Gaps:112/555 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 LVLATIGL--LLFKWSTGTFKAFEGRNLYFEKPYP-----FLGNMAASALQKASFQKQISEFYNR 65
            |:|..||.  ||.:..|.|:..:...:...:.|.|     |||::....                
Mouse    25 LLLLLIGASWLLARVLTQTYIFYRTYHHLCDFPQPPKWNWFLGHLGMIT---------------- 73

  Fly    66 TRHHKLVGLFNLRT--------------PMIQINDPQLIKKICVKDFDHFPNHQTLNIPNERLV- 115
            ...|.|..:.||..              |:|.:..|.:|:.:.         :.:.::..:.:| 
Mouse    74 PTEHGLKEVTNLVATYPQGFMTWLGPIIPIITLCHPDIIRSVL---------NASASVALKEVVF 129

  Fly   116 --------NDMLNVMRDQHWRNMRSVLTPVFTSAKMRNMFTLMNESFAQCLEHLKSSQPIAAGEN 172
                    .|.|.:.....|.:.|.:|||.|....::....:.|:|  ..:.|.| .|.:|:|.:
Mouse   130 YSFLKPWLGDGLLLSDGDKWSSHRRMLTPAFHFNILKPYVKIFNDS--TNIMHAK-WQHLASGGS 191

  Fly   173 AFELDMKVLCNKLSNDVIATTAFGLKVNSFDD--PENEFHTIGKTLAFSRGLPFLKFMMCLLAPK 235
            | .||:....:.::.|.:....|     |||.  .||....|...|..| .|...::...||  .
Mouse   192 A-RLDVFENISLMTLDSLQKCVF-----SFDSNCQENPSEYISAILELS-ALVTKRYHQLLL--H 247

  Fly   236 VFNFFKLTI----FDST--NVEYFVRLVV-------------DAMQYREKHNITRPDMIQLLMEA 281
            :.:.::||.    |...  .|..|...|:             |.::.:.|....  |.|.:|:.:
Mouse   248 IDSLYQLTCSGRRFHKACHLVHSFTDAVIQDRRRTLPSKHEDDVLKAKAKSKTL--DFIDVLLLS 310

  Fly   282 KKESKDNWTDDEIVAQCFIFFFAAFENNSNLICTTAYELLRNLDIQERLYEEVKE-------TQE 339
            |.|.....:|::|.|:...|.|...:..::.:....|.|.|:.:.|||..:||:|       |:.
Mouse   311 KDEDGKELSDEDIRAEADTFMFEGHDTTASGLSWILYNLARHPEYQERCRQEVQELLRDRESTEI 375

  Fly   340 ALKGAPLTYDAAQEMTYMDMVISESLRKWTLSAAADRLCAKDYTLTDDEGTKLFEFKAGDNINIP 404
            ....|....|...::.::.|.|.||||.........|.|.:|..|.|..     ....|....|.
Mouse   376 ECSCAVFLRDDLAQLPFLTMCIKESLRLHPPVTVISRRCTQDIVLPDGR-----VIPKGVICIIN 435

  Fly   405 ICGLHWDERFFPQPQRFDPERFSERRKKDLIPYTYLPFGVGPRSCIGNRYAVMQAKGMLYNLMLN 469
            |...|.:...:|.|:.:||.||.....||..|..::||..|||:|||..:|:.:.|..|...:|.
Mouse   436 IFATHHNPTVWPDPEVYDPFRFDPENIKDRSPLAFIPFSAGPRNCIGQTFAMNEMKVALALTLLR 500

  Fly   470 YKI---EASPRTTRDMWESARGFNIIPTTGFWMQL 501
            :::   :..||...::...|.|       |.|:::
Mouse   501 FRVLPDDKEPRRKPELILRAEG-------GLWLRV 528

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp9b1NP_523645.1 p450 37..478 CDD:299894 112/499 (22%)
Cyp4f15NP_598888.1 p450 57..526 CDD:278495 116/519 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100014
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.