DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp9b1 and LOC105945483

DIOPT Version :9

Sequence 1:NP_523645.1 Gene:Cyp9b1 / 35634 FlyBaseID:FBgn0015038 Length:505 Species:Drosophila melanogaster
Sequence 2:XP_031756601.1 Gene:LOC105945483 / 105945483 -ID:- Length:492 Species:Xenopus tropicalis


Alignment Length:515 Identity:118/515 - (22%)
Similarity:204/515 - (39%) Gaps:108/515 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    40 PFLGNM-------AASALQKASFQKQISEFYNRTRHHKLVGLFNLRTPMIQINDPQLIKKICVKD 97
            |.|||:       ....|||      .||.|.     .:..::...||.:.:...:.||::.|..
 Frog    35 PVLGNILQMDFSNPLKDLQK------FSEVYG-----PVYSIYLGFTPAVVVRGLKSIKEVLVNK 88

  Fly    98 FDHFPNHQTLNIPNERLVNDMLNVMR-------DQHWRNMRSVLTPVFTSAKMRNMFTLMNESFA 155
            ...|...     |..| :.|:::..:       .|.|:..|.     ||.:.:|: |.|..:|..
 Frog    89 GTDFAGR-----PQNR-ITDVISKSKGLVVAPYGQAWKEHRR-----FTLSTLRS-FGLGKKSME 141

  Fly   156 QCLE----HLKSSQPIAAGENAFELDMK---VLCNKLSNDVIATTAFGLKVNSFDDP-ENEFHTI 212
            ..::    ||     |.|.:|:.::...   ||.|.:|| :|.:..||.:.:..|.. :|..:.:
 Frog   142 DRIQEENMHL-----IQAFKNSKDVLFDPHFVLENAVSN-IICSIVFGRRYDYNDTSFQNILNLV 200

  Fly   213 GKTLAFSRG--------LPFLKFMMCLLAPKVFNFFKLTIFDSTNVEY-FVRLVVDAMQYREKHN 268
            .:.:..:.|        ..|::|:.  |..|       .||.:.:|.: |:..||      |:|.
 Frog   201 HENMKLATGFWAQLYNAFGFIQFLP--LPHK-------KIFQNVDVVFAFLGKVV------EEHK 250

  Fly   269 IT----RP-DMIQLLME--AKKESKDN---WTDDEIVAQCFI-FFFAAFENNSNLICTTAYELLR 322
            .|    .| |.|...:|  .||:.:|.   ..|:|.:..|.. .|.|..|..::.:......:|:
 Frog   251 ETLLPGEPRDYIDCYLEELKKKQEEDGNKMTFDEENLFSCVADLFVAGTETTTSSLEWCLLYMLK 315

  Fly   323 NLDIQERLYEEVKETQEALKGAP--LTYDAAQEMTYMDMVISESLRKWT-LSAAADRLCAKDYTL 384
            ..:|||:.:||:    :.:.|..  |.|:..:.|.|...|:.|..|..: :.........:|..|
 Frog   316 FPEIQEKCHEEI----DRVFGNKNCLEYEDRERMPYTQAVLQEVQRHASVVPLGVSHSPIRDVHL 376

  Fly   385 TDDEGTKLFEFKAGDNINIPICGLHWDERFFPQPQRFDPERFSERRKKDLIPYTYLPFGVGPRSC 449
            ..      |....|..|...:..:|:|:..:..|..|:||.|.....:.:....:|||..|||.|
 Frog   377 NG------FFIPKGTVIITDLSSVHYDKTHWKYPHEFNPENFLNENGELIKTEAFLPFSAGPRVC 435

  Fly   450 IGNRYAVMQA----KGMLYNLMLNYKIEASPRTTRDMWESARGFNIIPTTGFWMQLVSRK 505
            :|...|.|:.    ..||.:...::....||...|.::    |.:..| ..:.|::||||
 Frog   436 LGENLARMEIFLFFTAMLQHFEFHWPDPTSPPDLRPVF----GLSQAP-KHYKMRIVSRK 490

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp9b1NP_523645.1 p450 37..478 CDD:299894 110/486 (23%)
LOC105945483XP_031756601.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D467733at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.