DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp9b1 and tbxas1

DIOPT Version :9

Sequence 1:NP_523645.1 Gene:Cyp9b1 / 35634 FlyBaseID:FBgn0015038 Length:505 Species:Drosophila melanogaster
Sequence 2:XP_031753608.1 Gene:tbxas1 / 100327243 XenbaseID:XB-GENE-994325 Length:532 Species:Xenopus tropicalis


Alignment Length:561 Identity:163/561 - (29%)
Similarity:267/561 - (47%) Gaps:102/561 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 VEICLVLATIGLLLFKWSTGTFKAFEGRNLYFEKPYPFLGNMAASALQKASFQKQISEFYNRTRH 68
            |.:.||...:| ||:.:|...|...|...:...||.||:||:..       |||   .|:...||
 Frog    14 VTLTLVAGFLG-LLYWYSVSAFWQLEKAGIKHPKPLPFIGNIML-------FQK---GFWEGDRH 67

  Fly    69 -----HKLVGLFNLRTPMIQINDPQLIKKICVKDFDHFPNH-QTLNIPNERLVNDMLNVMRDQHW 127
                 ..:.|.:..|.|||.|.:|..||::..|||.:|.|. |.||:..:.: :|.|..:||..|
 Frog    68 LLKTYGPICGYYMGRRPMIVIAEPDAIKQVLQKDFVNFTNRMQRLNLVTKPM-SDSLLCLRDDKW 131

  Fly   128 RNMRSVLTPVFTSAKMRNMFTLMNESFAQCLEHL-KSSQPIAAGENAFELDMKVLCNKLSNDVIA 191
            :.:||||||.|::|:|:.|..|:|    ||.:.| ::....|:...|..:.....|  .:.||:|
 Frog   132 KRVRSVLTPSFSAARMKEMCPLIN----QCCDVLVENLMEYASSGEACNVQRCYAC--FTMDVVA 190

  Fly   192 TTAFGLKVNSFDDPEN----------EFHTIGKTLAFSRGLPFLKFMMCLLAPKVF--------N 238
            :.|||.:|:|..|.::          |..|..|.:.          ::||..|.:.        |
 Frog   191 SVAFGTQVDSQRDSDHPLVQNCKRFLELFTPFKPVV----------LLCLAFPSIMIPIARRLPN 245

  Fly   239 FFKLTIFDSTNVEYFVRLVVDAMQYREKH--NITRPDMIQLLMEA-------------------- 281
            ..:    |..| .:|::::.|.:.:||..  |..|.|.:||:::|                    
 Frog   246 KHR----DRIN-SFFLKVIRDIIAFRENQPPNERRRDFLQLMLDARDSAGHVSVDHFDIVNQADL 305

  Fly   282 -------------KKESKDNWTDDEIVAQCFIFFFAAFENNSNLICTTAYELLRNLDIQERLYEE 333
                         :|.::....::||:.|.|||..|.:|...:|:...:|.|..:.|.||:|.:|
 Frog   306 SVPQNQDRGQDPPRKSTQKTLNEEEILGQAFIFLIAGYETTCSLLSFASYLLATHPDCQEKLLKE 370

  Fly   334 VKETQEALKGAPLTYDAAQEMTYMDMVISESLRKWTLSAAADRLCAKDYTLTDDEGTKLFEFKAG 398
            |.|..:..:.|  .|:...::.||:|||:|:||.:..:....|..|:|.|:..      ....||
 Frog   371 VDEFSQEHEEA--DYNTVHDLPYMEMVINETLRMYPPAYRFAREAARDCTVMG------LGIPAG 427

  Fly   399 DNINIPICGLHWDERFFPQPQRFDPERFSERRKKDLIPYTYLPFGVGPRSCIGNRYAVMQAKGML 463
            ..:.|||..|..|.||:.:|::|:||||:...|:...|:.:||||.|||||||.|.|:::||..|
 Frog   428 AVVEIPIGCLQNDPRFWHEPEKFNPERFTAEEKQKRHPFLFLPFGAGPRSCIGMRLALLEAKITL 492

  Fly   464 YNLMLNYKIEASPRTTRDMWESARGFNIIPTTGFWMQLVSR 504
            |.::..::.:....|...:..||. ..:.|..|.::::|:|
 Frog   493 YRVLRKFRFQTCDLTQIPLQLSAM-TTLRPKDGVYVRVVAR 532

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp9b1NP_523645.1 p450 37..478 CDD:299894 147/500 (29%)
tbxas1XP_031753608.1 cytochrome_P450 71..526 CDD:425388 140/485 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D264519at33208
OrthoFinder 1 1.000 - - FOG0000037
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X40
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.