DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp9b1 and Cyp4a32

DIOPT Version :9

Sequence 1:NP_523645.1 Gene:Cyp9b1 / 35634 FlyBaseID:FBgn0015038 Length:505 Species:Drosophila melanogaster
Sequence 2:NP_001093651.1 Gene:Cyp4a32 / 100040843 MGIID:3717148 Length:509 Species:Mus musculus


Alignment Length:519 Identity:116/519 - (22%)
Similarity:204/519 - (39%) Gaps:123/519 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    45 MAASALQKASFQKQIS-------------------EFYNRTRHHK--LVGLFNLRTPMI------ 82
            |:.|||....|...:|                   :||   .|.|  |..|....:|..      
Mouse     1 MSVSALSPTRFADSLSGFLQVASVLGLLLLLVKAVQFY---LHRKWLLKALQQFPSPPFHWFFGH 62

  Fly    83 -QINDPQLIKKICVKDFDHFPN-----------HQTLNIPNERLV---------NDM-------- 118
             |....|.:|:: |...:|||:           :.|:..|:...|         |.:        
Mouse    63 EQFKGEQELKEV-VSCIEHFPSAFPCWFWGSNAYLTVYDPDYMKVILGRSDPKANGIYRLLAPWI 126

  Fly   119 ---LNVMRDQHWRNMRSVLTPVFTSAKMRNMFTLMNESFAQCLEHLKSSQPIAAGENAFELDMKV 180
               |.::..|.|...|.:|||.|....::.....|.:|....|:   ..:.:|..:::.|:...:
Mouse   127 GYGLLLLNGQPWFQHRRMLTPAFHYDILKPYVKNMADSIRLMLD---KWERLAGQDSSIEIFQHI 188

  Fly   181 LCNKLSNDVIATTAFGLK------------VNSFDDPENEFH-----------TIGKTLAFSRGL 222
              :.::.|.:...||..|            :.:..|..|.||           ||.:..:..|  
Mouse   189 --SLMTLDTVMKCAFSHKGSVQVDGNYKTYLQAIGDLNNLFHSRVRNIFHQNDTIYRLSSNGR-- 249

  Fly   223 PFLKFMMCLLAPKVFNFFKLTIFDSTNVEYFVRLVVDAMQYR-EKHNI---TRPDMIQLLMEAKK 283
              |....|.||           .|.|  :..:::..|.:|.. |..||   .|.|.:.:|:.|:.
Mouse   250 --LAKQACQLA-----------HDHT--DGVIKMRKDQLQDEGELENIKKKRRLDFLDILLFARM 299

  Fly   284 ESKDNWTDDEIVAQCFIFFFAAFENNSNLICTTAYELLRNLDIQERLYEEVKETQEAL-KGAPLT 347
            |:.|:.:|.::.|:...|.|...:..::.:....|.|..:.:.|:|..|||   |..| .|:.:|
Mouse   300 ENGDSMSDKDLRAEVDTFMFEGHDTTASGVSWIFYALATHPEHQQRCREEV---QSLLGDGSSIT 361

  Fly   348 YDAAQEMTYMDMVISESLRKWTLSAAADRLCAKDYTLTDDEGTKLFEFKAGDNINIPICGLHWDE 412
            :|...::.|..|.|.|:||.:.......|..:...|..|  |..|   ..|..:.:.|.|||.:.
Mouse   362 WDHLDQIPYTTMCIKEALRLYPPVPGIVRELSTSVTFPD--GRSL---PKGVQVTLSIYGLHHNP 421

  Fly   413 RFFPQPQRFDPERFSERRKKDLIPYTYLPFGVGPRSCIGNRYAVMQAKGMLYNLMLNYKIEASP 476
            :.:|.|:.|||.||:....:.  .:::|||..|.|:|||.::|:.:.|.::...:|::::...|
Mouse   422 KVWPNPEVFDPSRFAPDSPRH--SHSFLPFSGGARNCIGKQFAMSELKVIVALTLLHFELLPDP 483

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp9b1NP_523645.1 p450 37..478 CDD:299894 116/519 (22%)
Cyp4a32NP_001093651.1 p450 52..503 CDD:278495 104/465 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100014
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.