DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tsp42Er and CD63

DIOPT Version :9

Sequence 1:NP_523644.1 Gene:Tsp42Er / 35629 FlyBaseID:FBgn0033139 Length:211 Species:Drosophila melanogaster
Sequence 2:NP_001244318.1 Gene:CD63 / 967 HGNCID:1692 Length:238 Species:Homo sapiens


Alignment Length:224 Identity:56/224 - (25%)
Similarity:101/224 - (45%) Gaps:45/224 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 LMIRYLAFLFNFLCAV----LGIATIVVNVIAIDQIAPKDQLILGLYIAVGSIVFLLSFFGCFGA 66
            |.:..|||.   .|||    :|:...:|....|.|.|....|:..:.||||..:||::|.||.||
Human    14 LYVLLLAFC---ACAVGLIAVGVGAQLVLSQTIIQGATPGSLLPVVIIAVGVFLFLVAFVGCCGA 75

  Fly    67 IKESIC--VTWAYATSMLVML-IVSIVMLFVFR---MHFEEDSITKLKQAFAKQTNTFDAMAEYQ 125
            .||:.|  :|:|...|::::: :.:.:..:|||   |....::..:..:.:.|..:|...:...|
Human    76 CKENYCLMITFAIFLSLIMLVEVAAAIAGYVFRDKVMSEFNNNFRQQMENYPKNNHTASILDRMQ 140

  Fly   126 TQYQCCGIYKLKDY----GDAYITVPSSC---------YDQNDTP-YRDGCLAKMETQYEELLKG 176
            ..::|||.....|:    ..:...||.||         .:.|:.. :::||:             
Human   141 ADFKCCGAANYTDWEKIPSMSKNRVPDSCCINVTVGCGINFNEKAIHKEGCV------------- 192

  Fly   177 PKIVGWM---LMVIEIGA--FTFSTIMGV 200
            .||.||:   ::|:...|  ..|..::|:
Human   193 EKIGGWLRKNVLVVAAAALGIAFVEVLGI 221

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tsp42ErNP_523644.1 Tetraspannin 8..195 CDD:278750 53/215 (25%)
tetraspanin_LEL 93..174 CDD:239401 18/97 (19%)
CD63NP_001244318.1 Tetraspannin 10..227 CDD:395265 56/224 (25%)
CD63_LEL 105..203 CDD:239419 22/110 (20%)
Lysosomal targeting motif. /evidence=ECO:0000250|UniProtKB:P41731 234..238
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3882
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.