DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tsp42Er and Tspan2

DIOPT Version :9

Sequence 1:NP_523644.1 Gene:Tsp42Er / 35629 FlyBaseID:FBgn0033139 Length:211 Species:Drosophila melanogaster
Sequence 2:NP_072111.1 Gene:Tspan2 / 64521 RGDID:620982 Length:221 Species:Rattus norvegicus


Alignment Length:217 Identity:53/217 - (24%)
Similarity:101/217 - (46%) Gaps:31/217 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 IRYLAFLFNFLCAVLGIATI----------VVNVIAIDQIAPKDQLILGLYIAV--GSIVFLLSF 60
            |:||...||.|..:.|.|.|          .:..::.::.:| :...:|||:.|  |:::..:.|
  Rat    11 IKYLLLGFNLLFWLAGSAVIAFGLWFRFGGTIKDLSSEEKSP-EYFYVGLYVLVGAGALMMAVGF 74

  Fly    61 FGCFGAIKESICVTWAYATSMLVMLIVSIVMLFVFRMHFEEDSITKLKQAFAKQTNTF------- 118
            |||.||::||.||..::.|.:|| :..:.|...||....::.:|..::..:.:..:.:       
  Rat    75 FGCCGAMRESQCVLGSFFTCLLV-IFAAEVTTGVFAFIGKDVAIRHVQSMYEEAYSDYVRDRGRG 138

  Fly   119 -DAMAEYQTQYQCCGIYKLKDYGDAYITVPSSCYDQNDTPYRDGCLAKMETQYEELLKGPKIVGW 182
             ..:..:.:.:||||    |:..:   .|..:|  ..:.|....|:.|:||.....|:...|||.
  Rat   139 NGTLITFHSAFQCCG----KESSE---QVQPTC--PKELPGHKNCIDKIETIISVKLQLIGIVGI 194

  Fly   183 MLMVIEIGAFTFSTIMGVSLRN 204
            .:..:.|....||.::..::||
  Rat   195 GIAGLTIFGMIFSMVLCCAIRN 216

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tsp42ErNP_523644.1 Tetraspannin 8..195 CDD:278750 49/206 (24%)
tetraspanin_LEL 93..174 CDD:239401 15/88 (17%)
Tspan2NP_072111.1 Tetraspannin 10..214 CDD:278750 51/213 (24%)
CD81_like_LEL 110..186 CDD:239404 13/84 (15%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3882
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.