DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tsp42Er and Tsp42Ea

DIOPT Version :9

Sequence 1:NP_523644.1 Gene:Tsp42Er / 35629 FlyBaseID:FBgn0033139 Length:211 Species:Drosophila melanogaster
Sequence 2:NP_525012.2 Gene:Tsp42Ea / 59178 FlyBaseID:FBgn0029508 Length:226 Species:Drosophila melanogaster


Alignment Length:222 Identity:65/222 - (29%)
Similarity:107/222 - (48%) Gaps:19/222 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 MIRYLAFLFNFLCAVLGIATIVVNVIAIDQIAPKDQLILGL--------YIAVGSIVFLLSFFGC 63
            |::|:.|:||.||::.||..||...:...::...|.....|        .|.:|:|:.|:|:|||
  Fly     7 MVKYILFIFNLLCSICGILLIVFGALLFSKVRNMDDFAEALRTQQVPVTMIILGTIILLISWFGC 71

  Fly    64 FGAIKESICVTWAYATSMLVMLIVSIVMLFVFRMHFEEDSITKL-----KQAFAKQTNTFDAMAE 123
            .|||:||.|::..|:..:.|::|..:.:  |..|..::|...::     ::|:..:|:..|.|..
  Fly    72 CGAIRESYCMSMTYSILLFVLMIGQLAL--VIYMWVQKDKYLEIMGDVVEKAWNHRTSRSDYMDA 134

  Fly   124 YQTQYQCCGIYKLKDYGDAYITVPSSCYDQN----DTPYRDGCLAKMETQYEELLKGPKIVGWML 184
            .|...:|||.....||.......||.|.|.|    :|.||.||.......::......|..|.::
  Fly   135 IQISMKCCGRSGYTDYAYQGKFPPSCCSDTNNCRWETVYRRGCKVTFVEFWDRNSDIIKYAGLVI 199

  Fly   185 MVIEIGAFTFSTIMGVSLRNELRRSAY 211
            ..||...|.|:..:..|:||..||:.|
  Fly   200 AAIEFVGFVFACCLANSIRNYRRRAEY 226

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tsp42ErNP_523644.1 Tetraspannin 8..195 CDD:278750 57/203 (28%)
tetraspanin_LEL 93..174 CDD:239401 23/89 (26%)
Tsp42EaNP_525012.2 Tetraspannin 8..217 CDD:278750 58/210 (28%)
tetraspanin_LEL 104..188 CDD:239401 21/83 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45467710
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3882
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1406905at2759
OrthoFinder 1 1.000 - - FOG0001737
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR19282
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.850

Return to query results.
Submit another query.