DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tsp42Er and cd81a

DIOPT Version :9

Sequence 1:NP_523644.1 Gene:Tsp42Er / 35629 FlyBaseID:FBgn0033139 Length:211 Species:Drosophila melanogaster
Sequence 2:NP_571593.2 Gene:cd81a / 58031 ZFINID:ZDB-GENE-000831-5 Length:236 Species:Danio rerio


Alignment Length:234 Identity:54/234 - (23%)
Similarity:95/234 - (40%) Gaps:50/234 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 IRYLAFLFNFL-----CAVLGIA--------TIVVNVIAIDQIAPKDQLILGLY--IAVGSIVFL 57
            |:|:.|.|||:     |.:||::        |..:..:..:.........:.:|  ||||:::..
Zfish    12 IKYMLFFFNFIFWLAGCVILGVSLWLRHDTKTSSLLDLKYEGTESPTTFYISVYILIAVGAVMMF 76

  Fly    58 LSFFGCFGAIKESICVTWAYATSMLVMLIVSIVMLFVFRM------HFEEDSITKLKQAFAKQTN 116
            :.|.||:|||:||.|        :|......:|:||...:      ...:|.|:  |:......:
Zfish    77 VGFLGCYGAIQESQC--------LLGTFFACLVLLFACEVAAGIWGFMNKDKIS--KEVIGFYDS 131

  Fly   117 TFDAMAEYQTQ---------------YQCCGIYKL-KDYGDAYITVPSSCYDQNDTPYRDGCLAK 165
            .:|..|.|.|.               .||||...| ....|.::|  .:|.:...|...| |..:
Zfish   132 VYDKGATYNTDNKNPATAVLKVFHETLQCCGKGNLFTAIVDRWLT--DTCPEHLRTNAVD-CHTE 193

  Fly   166 METQYEELLKGPKIVGWMLMVIEIGAFTFSTIMGVSLRN 204
            ::..:.:.:....|...::.||.|....||.::...:||
Zfish   194 IKNLFTDKISLIGIAALVVAVIMIFEMIFSMVLCCGIRN 232

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tsp42ErNP_523644.1 Tetraspannin 8..195 CDD:278750 50/223 (22%)
tetraspanin_LEL 93..174 CDD:239401 19/102 (19%)
cd81aNP_571593.2 Tetraspannin 11..230 CDD:278750 52/230 (23%)
CD81_like_LEL 115..202 CDD:239404 18/91 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3882
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.