DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tsp42Er and tspan3b

DIOPT Version :9

Sequence 1:NP_523644.1 Gene:Tsp42Er / 35629 FlyBaseID:FBgn0033139 Length:211 Species:Drosophila melanogaster
Sequence 2:NP_001076335.1 Gene:tspan3b / 569864 ZFINID:ZDB-GENE-070424-42 Length:253 Species:Danio rerio


Alignment Length:236 Identity:63/236 - (26%)
Similarity:100/236 - (42%) Gaps:64/236 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 CAVLGIATIVVNVIAIDQIAPKDQLILGLY------------------------IAVGSIVFLLS 59
            |.|:...|::|.:..|...|......:|.|                        ||||:::|::.
Zfish     4 CGVISSKTVLVFLNLIFWAAAGILCYIGAYVFITYDDYDHFFEDIYTFIPAMVIIAVGTLLFVIG 68

  Fly    60 FFGCFGAIKESICVTWAYATSMLVML---IVSIVMLFVFRMHFE---EDSITKLKQAFAKQTNTF 118
            |.||...|:||.|....::..:|::.   :|.:|:.:::|...|   ..||.|:...: |.||| 
Zfish    69 FIGCCATIRESRCGLVTFSAVLLLVFATEVVVVVLGYIYRAKVEAVVNHSIQKVYNEY-KGTNT- 131

  Fly   119 DAMA---EY-QTQYQCCGIYKLKDYGDAY-------ITVPSSCYD---QNDTP--------YRDG 161
            ||.:   :| |.|..||||:...|:.:.:       .:||.||..   .|.|.        |.:|
Zfish   132 DAPSRAIDYVQRQLHCCGIHNYSDWMNTHWFIESKNNSVPVSCCKPTISNRTGTLMRPGDLYPEG 196

  Fly   162 CLAKMETQYEELLKGPKIVGWMLMVIEIGAFTFSTIMGVSL 202
            |         |:|...|:...||.|| :.|.||:.|..:.|
Zfish   197 C---------EVLVVKKLKDIMLYVI-LAALTFAAIQMLGL 227

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tsp42ErNP_523644.1 Tetraspannin 8..195 CDD:278750 60/227 (26%)
tetraspanin_LEL 93..174 CDD:239401 29/105 (28%)
tspan3bNP_001076335.1 Tetraspannin 10..237 CDD:278750 61/230 (27%)
Tweety_N <58..>94 CDD:299916 13/35 (37%)
TM4SF8_like_LEL 104..209 CDD:239416 31/115 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3882
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1406905at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.