DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tsp42Er and tspan3a

DIOPT Version :9

Sequence 1:NP_523644.1 Gene:Tsp42Er / 35629 FlyBaseID:FBgn0033139 Length:211 Species:Drosophila melanogaster
Sequence 2:NP_001020709.1 Gene:tspan3a / 565579 ZFINID:ZDB-GENE-030131-7787 Length:253 Species:Danio rerio


Alignment Length:180 Identity:50/180 - (27%)
Similarity:84/180 - (46%) Gaps:46/180 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    49 IAVGSIVFLLSFFGCFGAIKESICVTWAYATSMLVML------IVSIVMLFVFRMHFEED---SI 104
            ||||:::|::...||...|:||.|   ..||.:::::      :|.:|:.:::|...|::   ||
Zfish    58 IAVGALLFIIGLIGCCATIRESRC---GLATFVIILMLVFVTEVVVVVLGYIYRAKVEDEVNHSI 119

  Fly   105 TKLKQAFAKQTNTFDAMA---EY-QTQYQCCGIYKLKDYGDA-------YITVPSSCYDQNDTP- 157
            .|:...: ..||| ||.:   :| |.|..||||....|:.:.       ..:||.||...|.:. 
Zfish   120 QKVYNEY-NGTNT-DAPSRAIDYVQRQLHCCGITNFADWRNTRWFKESKNNSVPLSCCKPNVSNC 182

  Fly   158 ----------YRDGCLAKMETQYEELLKGPKIVGWMLMVIEIGAFTFSTI 197
                      |.:||        |||:  .|.:..::|.:...|.||:.|
Zfish   183 TGSLLHPGDLYPEGC--------EELV--VKKLKEIMMYVIWAALTFAAI 222

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tsp42ErNP_523644.1 Tetraspannin 8..195 CDD:278750 48/176 (27%)
tetraspanin_LEL 93..174 CDD:239401 28/105 (27%)
tspan3aNP_001020709.1 Tetraspannin 10..237 CDD:278750 50/180 (28%)
TM4SF8_like_LEL 104..210 CDD:239416 30/117 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1406905at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.