DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tsp42Er and cd81b

DIOPT Version :9

Sequence 1:NP_523644.1 Gene:Tsp42Er / 35629 FlyBaseID:FBgn0033139 Length:211 Species:Drosophila melanogaster
Sequence 2:NP_001003735.1 Gene:cd81b / 445280 ZFINID:ZDB-GENE-040808-52 Length:238 Species:Danio rerio


Alignment Length:228 Identity:47/228 - (20%)
Similarity:94/228 - (41%) Gaps:34/228 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 IRYLAFLFNFLC-----AVLGIA------TIVVNVIAI----DQIAPKDQLILGLYIAVGSIVFL 57
            |:|:.|..||:.     .:||:|      :...|::.:    :|......:.:.:.||:|:|:..
Zfish    10 IKYMLFFLNFIFWLAGGVILGVALWLRHDSQTSNLLMLQFEGNQAPGTFYISVYVLIAIGAIMMF 74

  Fly    58 LSFFGCFGAIKESICVTWAYATSMLVMLIVSI---VMLFVFRMHFEEDSITKLKQAFAKQTNTFD 119
            :.|.||:|||:||.|:...:.|.::::....:   :..|:.|.....:.|.....|:.|..:..|
Zfish    75 VGFLGCYGAIQESQCLLGTFFTCLVILFACEVAAGIWGFINRDTISTELINFYDAAYIKAVDPVD 139

  Fly   120 AMAE---------YQTQYQCCGIYKLKDYGDAYITVPSSCYDQNDTP----YRDGCLAKMETQYE 171
            ..:.         :.....|||   ..|..|.:..|.:|...:...|    ....|..|:...:.
Zfish   140 TTSRQTASKVLEVFHDNLDCCG---KGDDNDLFKVVQTSLCPKKTFPLDPLISQSCHVKLRNLFS 201

  Fly   172 ELLKGPKIVGWMLMVIEIGAFTFSTIMGVSLRN 204
            |.|....:...::.||.:....|:.::..::||
Zfish   202 EKLHVIGLAALVIAVIMVFEMIFTMVLCCAIRN 234

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tsp42ErNP_523644.1 Tetraspannin 8..195 CDD:278750 44/217 (20%)
tetraspanin_LEL 93..174 CDD:239401 17/93 (18%)
cd81bNP_001003735.1 Tetraspannin 9..232 CDD:278750 45/224 (20%)
CD81_like_LEL 113..204 CDD:239404 17/93 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3882
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.