DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tsp42Er and tspan18a

DIOPT Version :9

Sequence 1:NP_523644.1 Gene:Tsp42Er / 35629 FlyBaseID:FBgn0033139 Length:211 Species:Drosophila melanogaster
Sequence 2:XP_021333136.1 Gene:tspan18a / 437007 ZFINID:ZDB-GENE-040718-232 Length:281 Species:Danio rerio


Alignment Length:225 Identity:57/225 - (25%)
Similarity:101/225 - (44%) Gaps:37/225 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 IRYLAFLFNFLCAVLGIATIVVNV-IAIDQ------IAPKDQLILGLY--IAVGSIVFLLSFFGC 63
            |:||.|:|||...:.|...:.|.: :.:|.      :|....|..|:|  :.:|.::|||.|.||
Zfish    49 IKYLMFIFNFFIFLGGSFLLGVGIWVLVDPTGFREIVAANSLLFTGVYAILIMGGMLFLLGFLGC 113

  Fly    64 FGAIKESICVTWAYATSMLVMLIVSI---VMLFVFRMHFEEDSITKLKQAFAKQTNTFDAMAE-- 123
            .|||:|:.|:...:...:||:.:..:   ::.|:||.|...|..||..:...:.||:.|....  
Zfish   114 CGAIRENKCLLLFFFMLILVIFLAELAVAILAFIFREHLTRDYFTKELKTHYQGTNSTDVFTSTW 178

  Fly   124 --YQTQYQCCGIYKLKDYGDAYI--------TVPSSCYDQND------------TPYRD-GCLAK 165
              ..|.:.|||:...:|:.|..:        .||..|..:.|            .|.|: ||.:.
Zfish   179 NAIMTTFNCCGVNSAEDFDDQSLFRRLNPSRIVPEVCCQRTDLMMSKEECLRGIMPIRNKGCYSA 243

  Fly   166 METQYEELLKGPKIVGWMLMVIEIGAFTFS 195
            :...:|..:.....:..:::.||:.|..|:
Zfish   244 VVDYFETYIYMAGALAIVVLTIELFAMVFA 273

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tsp42ErNP_523644.1 Tetraspannin 8..195 CDD:278750 56/223 (25%)
tetraspanin_LEL 93..174 CDD:239401 25/105 (24%)
tspan18aXP_021333136.1 Tetraspannin 49..278 CDD:306775 57/225 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3882
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.