DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tsp42Er and Tsp97E

DIOPT Version :9

Sequence 1:NP_523644.1 Gene:Tsp42Er / 35629 FlyBaseID:FBgn0033139 Length:211 Species:Drosophila melanogaster
Sequence 2:NP_001263002.1 Gene:Tsp97E / 43241 FlyBaseID:FBgn0039465 Length:228 Species:Drosophila melanogaster


Alignment Length:123 Identity:32/123 - (26%)
Similarity:53/123 - (43%) Gaps:14/123 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 NFLCAVLGIATIVVNVIAIDQIAPKDQLILGLYIAVGSIVFLLSFFGCFGAIKESICVTWAYATS 80
            |.|..::|...|.|.|.|.......:..|:|..:|.|.|:..:|..|..||:|        :...
  Fly    16 NILYVMIGFLLIGVGVYARAASIVTNLPIVGGILACGVILICISMLGLAGAVK--------HHQV 72

  Fly    81 MLVMLIVSIVMLFVFRMHFEEDSI---TKLKQAFAKQ---TNTFDAMAEYQTQYQCCG 132
            ||...::.:.|||:.:.......:   ::.:|.||:|   |...|...:.|...:|||
  Fly    73 MLFFYMIILFMLFLIQFSIASSCLAVNSEQQQQFAEQGWMTVPTDLRKQVQDSLKCCG 130

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tsp42ErNP_523644.1 Tetraspannin 8..195 CDD:278750 32/123 (26%)
tetraspanin_LEL 93..174 CDD:239401 11/46 (24%)
Tsp97ENP_001263002.1 Tetraspannin 7..204 CDD:278750 32/123 (26%)
tetraspanin_LEL <121..177 CDD:243179 4/10 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45442874
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3882
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR19282
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.