DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tsp42Er and Tsp66E

DIOPT Version :9

Sequence 1:NP_523644.1 Gene:Tsp42Er / 35629 FlyBaseID:FBgn0033139 Length:211 Species:Drosophila melanogaster
Sequence 2:NP_523985.1 Gene:Tsp66E / 39017 FlyBaseID:FBgn0035936 Length:267 Species:Drosophila melanogaster


Alignment Length:267 Identity:64/267 - (23%)
Similarity:111/267 - (41%) Gaps:79/267 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 RYLAFLFNFLCAVLGIATIVVNV---IAIDQ---IA---------------PK--DQLILGLYIA 50
            :||..:|||:..|||  ||:..|   :|:|:   ||               |:  :||...| :.
  Fly    11 KYLLCIFNFIFFVLG--TIIFGVGLWLAVDKHSLIALLKLVESERIEQFTQPQAIEQLAYVL-LV 72

  Fly    51 VGSIVFLLSFFGCFGAIKESICVTWAYATSMLVMLIVSIVMLFVFRMHFEEDSITKLKQAFAKQT 115
            :|:::|.:||.|..||::||.|:...|.|.::::||..||...:..  |.:|.:....:.|.:.|
  Fly    73 IGAVMFFMSFLGYLGAMRESRCLLSTYGTFLILLLIAEIVAGGLGA--FFKDKVRAESKNFLQTT 135

  Fly   116 NTFDAMAE-----------YQTQYQCCGIYKLKDY--------GDAYITVPSSC----------- 150
            .|..::.|           ....:.||||....|:        |....|:|.:|           
  Fly   136 ITSYSLGENVDATSLMWNQLMGNFGCCGINDYHDFDASPAWVNGKGNRTIPDACCILKDVAKLVP 200

  Fly   151 YDQNDTP--------YRDGCLAKMETQYEELLKGPKIVGWMLMVIEIG-------AFTFSTIMGV 200
            .|::.|.        |:.||   .|...|.|::..::|   ::.|.:|       ...|:.....
  Fly   201 RDEDCTTNPSDSNSFYKKGC---YEVFTEWLIRQRELV---IVAIAVGIVHLVLIILAFALCKAF 259

  Fly   201 SLRNELR 207
            :..|::|
  Fly   260 AKYNDMR 266

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tsp42ErNP_523644.1 Tetraspannin 8..195 CDD:278750 61/253 (24%)
tetraspanin_LEL 93..174 CDD:239401 22/118 (19%)
Tsp66ENP_523985.1 Tetraspannin 9..258 CDD:278750 62/257 (24%)
uroplakin_I_like_LEL 116..231 CDD:239409 23/119 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45442974
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3882
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR19282
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.