DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tsp42Er and tspan2a

DIOPT Version :9

Sequence 1:NP_523644.1 Gene:Tsp42Er / 35629 FlyBaseID:FBgn0033139 Length:211 Species:Drosophila melanogaster
Sequence 2:NP_001018160.1 Gene:tspan2a / 378854 ZFINID:ZDB-GENE-050522-511 Length:211 Species:Danio rerio


Alignment Length:223 Identity:54/223 - (24%)
Similarity:100/223 - (44%) Gaps:53/223 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 IRYLAFLFNFLCAVLGIATIVVNV----------IAIDQIAPKDQLILGLYIAVGS--IVFLLSF 60
            ::||.|:|||:..:.|...:.|.:          :..:..|| :...:.:||.:|:  |:.::.|
Zfish    11 VKYLLFVFNFIFWLSGSLVLAVGLWLRFDPDTTSLLSENDAP-ENFFIAVYILIGAGGIMMIVGF 74

  Fly    61 FGCFGAIKESICVTWAYATSMLVMLIVSIVM-LFVFRMHFEEDSITKLKQAF----AKQTNTFDA 120
            ||||||::||.|:..::...:|::....:.. :|.|   ..:|.|.|..|.:    .|..|....
Zfish    75 FGCFGAVRESQCLLGSFFACLLLIFGAEVAAGVFGF---LNKDQIIKEVQNYYESATKMENGTVI 136

  Fly   121 MAEYQTQYQCCGIYKLKDYGDAYITVPS---SCYDQNDTPYRDGCLAKMETQYEELLKGPKIVGW 182
            .:.:.:...|||            |..|   :|.:.|    :| |:..:|..:.|.|   .|:|:
Zfish   137 TSAFHSVLDCCG------------TESSPIETCTEGN----KD-CVQAIEDFFNEKL---FIIGY 181

  Fly   183 M------LMVIEIGAFTFSTIMGVSLRN 204
            :      :|||   ...||.::..::||
Zfish   182 VGIGIAGVMVI---GMIFSMVLCCAIRN 206

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tsp42ErNP_523644.1 Tetraspannin 8..195 CDD:278750 50/212 (24%)
tetraspanin_LEL 93..174 CDD:239401 19/87 (22%)
tspan2aNP_001018160.1 Tetraspannin 10..204 CDD:278750 52/219 (24%)
tetraspanin_LEL 110..176 CDD:243179 18/85 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3882
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.