DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tsp42Er and Tsp42En

DIOPT Version :9

Sequence 1:NP_523644.1 Gene:Tsp42Er / 35629 FlyBaseID:FBgn0033139 Length:211 Species:Drosophila melanogaster
Sequence 2:NP_001260758.1 Gene:Tsp42En / 35624 FlyBaseID:FBgn0033135 Length:218 Species:Drosophila melanogaster


Alignment Length:214 Identity:55/214 - (25%)
Similarity:107/214 - (50%) Gaps:13/214 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 IRYLAFLFNFLCAVLGIATIVVNVIAIDQIAPK--DQLILGLYIAVGSIVFLLSFFGCFGAIKES 70
            ::.:..:.|.|.:::|:..|.::|..::...|.  :.:.:.:.|.||:.|.|.||.|||...:.|
  Fly     8 LKAVLIVLNVLLSLIGVTLIALSVYELNSSTPGTFEHIAIVVQIFVGTFVVLTSFLGCFATARVS 72

  Fly    71 ICVTWAYATSMLVMLIVSIVMLFVFRMHFEEDSITKLKQAF----AKQTNTFDAMAEYQTQYQCC 131
            :.:.|:|...:|::|.:.|   ::.......|.:.:.|:.|    |.|....:.::..:.:|.||
  Fly    73 LGLVWSYVICLLILLCLQI---YIIAAAHSTDYVERSKKDFLATWADQRTNVERISLLEQKYSCC 134

  Fly   132 GIYKLKDYGDAYITVPSSCY-DQNDTPY---RDGCLAKMETQYEELLKGPKIVGWMLMVIEIGAF 192
            |.....||......:|.||| ||....|   ..|||..::....:.:....|:.|:|:::|..|.
  Fly   135 GQLGAHDYILMGRGIPLSCYKDQERREYSLFSGGCLQAVQAHATDNVAIGLIIKWLLLLVEFAAL 199

  Fly   193 TFSTIMGVSLRNELRRSAY 211
            ..:|.:|:::||:|||..:
  Fly   200 GAATHLGITVRNKLRRERF 218

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tsp42ErNP_523644.1 Tetraspannin 8..195 CDD:278750 48/196 (24%)
tetraspanin_LEL 93..174 CDD:239401 21/88 (24%)
Tsp42EnNP_001260758.1 Tetraspannin 8..199 CDD:278750 47/193 (24%)
tetraspanin_LEL 96..180 CDD:239401 21/83 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45467705
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3882
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0001737
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR19282
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.840

Return to query results.
Submit another query.