DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tsp42Er and Tsp42Ek

DIOPT Version :9

Sequence 1:NP_523644.1 Gene:Tsp42Er / 35629 FlyBaseID:FBgn0033139 Length:211 Species:Drosophila melanogaster
Sequence 2:NP_001246161.1 Gene:Tsp42Ek / 35621 FlyBaseID:FBgn0033133 Length:215 Species:Drosophila melanogaster


Alignment Length:202 Identity:62/202 - (30%)
Similarity:97/202 - (48%) Gaps:22/202 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MGWSPLMIRYLAFLFNFLCAVLGIATIVVNVIAIDQIAPKDQLILGLYIAVGSIVFLLSFFGCFG 65
            ||.:...::......|.|.|:.|::.|.:..:|:.: || ...||.|| .:|.|:|:.:..||.|
  Fly     1 MGCTSGCVKCFLNTLNTLNALSGLSLIAIATLALSK-AP-IAYILFLY-GLGGIIFVSAVLGCCG 62

  Fly    66 AIKESICVTWAYATSMLVMLIVSIVMLFVFRMHFEEDSITK-----LKQAFAKQTNTFDAMAEYQ 125
            ...|::|:|..|...:|..||:|  :|.:||..|.|:.|.|     ::..:.::.....||..||
  Fly    63 ICMENVCMTATYGFLLLAQLIIS--LLGIFRFKFTEEYIEKFAAEEVQMKWDEELVEPGAMDIYQ 125

  Fly   126 TQYQCCGIYKLKDYGDAYI-----TVPSSCYDQNDTP---YRDGCLAKMETQYEELLKGPKIVGW 182
            |.|:|||    :|..|.|:     |:|.|||.|.|..   |..||:.|....:..|........|
  Fly   126 TVYECCG----RDSPDDYVAIGRQTLPPSCYPQEDPQMPHYLAGCVQKSSENFVVLFSYAHDTNW 186

  Fly   183 MLMVIEI 189
            :.:.|.|
  Fly   187 IALGITI 193

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tsp42ErNP_523644.1 Tetraspannin 8..195 CDD:278750 60/195 (31%)
tetraspanin_LEL 93..174 CDD:239401 29/93 (31%)
Tsp42EkNP_001246161.1 Tetraspannin 7..202 CDD:278750 60/196 (31%)
tetraspanin_LEL 94..174 CDD:239401 27/83 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3882
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1406905at2759
OrthoFinder 1 1.000 - - FOG0001737
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR19282
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.920

Return to query results.
Submit another query.