DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tsp42Er and Tsp42Eg

DIOPT Version :9

Sequence 1:NP_523644.1 Gene:Tsp42Er / 35629 FlyBaseID:FBgn0033139 Length:211 Species:Drosophila melanogaster
Sequence 2:NP_523633.1 Gene:Tsp42Eg / 35616 FlyBaseID:FBgn0033128 Length:218 Species:Drosophila melanogaster


Alignment Length:221 Identity:52/221 - (23%)
Similarity:96/221 - (43%) Gaps:16/221 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MGWSPLMIRYLAFLFNFLCAVLGIATIVVNVIAIDQIAPKDQLILGLYIAVGSIVFLLSFFGCFG 65
            |..|..:::..|..::.:.|:.|:..|.:.|..|.:....:.... :.||||.:|.|.:.||..|
  Fly     1 MACSTNVLKGFALFWDIILALFGLVVIGLGVHIIYKFEHFNTAAF-VIIAVGVVVVLTALFGALG 64

  Fly    66 AIKESICVTWAYATSMLVMLIVSIVMLFVFRMHFEEDSITKLKQAFAKQTN---------TFDAM 121
            |.:||...:..:.. :|::|::..|:...|...|:...:..:.:.|.|..|         ....:
  Fly    65 AARESSATSKVFVV-ILIVLVILEVLAVGFLWVFQTSLLINVDKTFDKLWNDQPVPIKPGNQSQI 128

  Fly   122 AEYQTQYQCCGIYKLKDYGDAYITVPSSCYD-QNDTPYRDGCLAKMETQYEELLKGPKIVGWMLM 185
            |..:....|||.....|    ||..|:|||: ::|....:||..|......:......:|..:|:
  Fly   129 ASLERWLDCCGNVGPSD----YILPPNSCYNGESDKLNLEGCRQKFLDFIADRWTTFNLVSLVLL 189

  Fly   186 VIEIGAFTFSTIMGVSLRNELRRSAY 211
            .:|:.....:.::..|:.|..|||.|
  Fly   190 GVELICALLAYVLANSIVNRWRRSKY 215

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tsp42ErNP_523644.1 Tetraspannin 8..195 CDD:278750 44/196 (22%)
tetraspanin_LEL 93..174 CDD:239401 20/90 (22%)
Tsp42EgNP_523633.1 Tetraspannin 17..202 CDD:395265 43/190 (23%)
tetraspanin_LEL 95..176 CDD:239401 19/84 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45442993
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3882
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0001737
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR19282
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.840

Return to query results.
Submit another query.