DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tsp42Er and Tsp42Ef

DIOPT Version :9

Sequence 1:NP_523644.1 Gene:Tsp42Er / 35629 FlyBaseID:FBgn0033139 Length:211 Species:Drosophila melanogaster
Sequence 2:NP_523632.2 Gene:Tsp42Ef / 35615 FlyBaseID:FBgn0033127 Length:220 Species:Drosophila melanogaster


Alignment Length:218 Identity:50/218 - (22%)
Similarity:101/218 - (46%) Gaps:18/218 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 IRYLAFLFNFLCAVLGIATIVVNV-IAID-QIAPKDQLILGLYIAVGSIVFLLSFFGCFGAIKES 70
            ::.:.:..:.||.:|.:..|...: :|:. .:....||....|:.:|:...|:..:|...|.:|:
  Fly     7 VKLIVYALDVLCTLLALVLISFGIYVAVSYNLNEIGQLTAYGYVGLGAAALLVVLWGYLSAWREN 71

  Fly    71 ICVTWAYATSMLVMLIVSIVMLF--VFRMHFEEDSITK-----LKQAFAKQTNTFDAMAEYQTQY 128
            :|.|    .:.::.|.:.|:..|  |:.:..:|.::..     |:..:.::.|:..||:.||..:
  Fly    72 VCCT----VTFIIFLCLVIIAQFAVVYLLITQEKTVASNLANALEATWEEELNSPGAMSLYQNWF 132

  Fly   129 QCCGIYKLKDYGDAYITVPSSCYDQNDTP-----YRDGCLAKMETQYEELLKGPKIVGWMLMVIE 188
            ||||....:||.......|.:|:..:|..     ...||..:.|..::.|.|...|:..:|:..|
  Fly   133 QCCGRGSPQDYIVNERLPPETCFRNHDKSKPENLIHTGCRVEFENYWQHLTKIFNILALVLIGFE 197

  Fly   189 IGAFTFSTIMGVSLRNELRRSAY 211
            :.....|..:..|:||:.|||.:
  Fly   198 LLLSVISCRLCNSIRNDARRSYF 220

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tsp42ErNP_523644.1 Tetraspannin 8..195 CDD:278750 43/200 (22%)
tetraspanin_LEL 93..174 CDD:239401 21/92 (23%)
Tsp42EfNP_523632.2 Tetraspannin 7..211 CDD:278750 44/207 (21%)
tetraspanin_LEL 103..181 CDD:239401 18/77 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45442995
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3882
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1406905at2759
OrthoFinder 1 1.000 - - FOG0001737
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR19282
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.850

Return to query results.
Submit another query.