DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tsp42Er and Tsp39D

DIOPT Version :9

Sequence 1:NP_523644.1 Gene:Tsp42Er / 35629 FlyBaseID:FBgn0033139 Length:211 Species:Drosophila melanogaster
Sequence 2:NP_523612.3 Gene:Tsp39D / 35405 FlyBaseID:FBgn0032943 Length:235 Species:Drosophila melanogaster


Alignment Length:240 Identity:57/240 - (23%)
Similarity:97/240 - (40%) Gaps:55/240 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 IRYLAFLFNFLCAVLGIATIVV------------NVIAIDQI--APKDQLILGLYIAVGSIVFLL 58
            ::||.|..|.|.|:.|:...:|            |.:: |.:  ||   :||   :.||:.|.::
  Fly     9 VKYLTFFCNLLFALTGLLIFLVGGMVQLNYAHYSNFVS-DHVWTAP---IIL---MIVGAAVAVI 66

  Fly    59 SFFGCFGAIKESICVTWAYATSMLVMLIVSIVMLFVFRM------------HFEEDSITKLKQAF 111
            .|.||.||:|||.|:..::|      |:..::.||...:            ...|.......|.:
  Fly    67 CFLGCCGALKESSCMILSFA------LLAVVIFLFEIGLGLAGYVKHTGLHQIMESQFNSTMQHY 125

  Fly   112 AKQTNTFDAMAEYQTQYQCCGIYKLKDYGDAY--ITVPSSCYD----------QNDTPYRDGCLA 164
            .::.:..||....||:..||||....|:...|  .|:|::|..          .|....:.|||.
  Fly   126 KERADYRDAWTLLQTELDCCGINGPNDWETVYRNSTLPAACCSVINLSEAKECTNTHATQHGCLQ 190

  Fly   165 KMETQYEELLKGPKIVGWMLMVIEIGAFTFSTIMGVSLRNELRRS 209
            |:    .|:|....::...:::...|....:.:....|....|||
  Fly   191 KL----LEILDSKTLILASVVLGVAGIQMLTILFACCLYRSFRRS 231

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tsp42ErNP_523644.1 Tetraspannin 8..195 CDD:278750 53/224 (24%)
tetraspanin_LEL 93..174 CDD:239401 22/104 (21%)
Tsp39DNP_523612.3 Tetraspannin 8..227 CDD:278750 54/234 (23%)
tetraspanin_LEL 104..200 CDD:239401 22/99 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3882
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR19282
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.