DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tsp42Er and Tsp29Fb

DIOPT Version :9

Sequence 1:NP_523644.1 Gene:Tsp42Er / 35629 FlyBaseID:FBgn0033139 Length:211 Species:Drosophila melanogaster
Sequence 2:NP_001137809.1 Gene:Tsp29Fb / 34212 FlyBaseID:FBgn0032075 Length:308 Species:Drosophila melanogaster


Alignment Length:247 Identity:61/247 - (24%)
Similarity:98/247 - (39%) Gaps:59/247 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 RYLAFLFNFLCAVLGIATIVVNVIAIDQIAPKDQLIL--------GLYIAVGSIVFLLSFFGCFG 65
            :|:..:.:|:.|:..|..|:|.. .|..|.....|.:        .|.||:|.|:..::..|.:|
  Fly    16 KYMLIIVSFMFALTAILLIMVGT-TIQTIFGDFSLFIDGHFSSPPALLIAIGFILIAVAALGAYG 79

  Fly    66 AIKESICVTWAYATSMLVMLIVSI---VMLFVFRMHFEEDSITKLKQAFAKQTNTFDAMAE---- 123
            |:|||:.|...|...:.::.|:.:   :..||.:.......|..:.||.|:..:  |...|    
  Fly    80 AVKESVMVINLYGVCLFLVFILEVSAAIAAFVMQSQVRGMLIRTMNQALAEYEH--DPYVESGVD 142

  Fly   124 -YQTQYQCCGIYKLKDYGDAY------------ITVPSSCYDQNDTPYRD------------GCL 163
             .|:..:|||:.:.:|:.|..            :.||:||.....|...|            ||.
  Fly   143 FMQSMLECCGVNEPEDWKDYLSANVNFTLGVDDVVVPNSCCGNQPTSLNDSTQMTCMETYDYGCF 207

  Fly   164 AKMETQYEELLKGPKIVGWMLMVIEIGAFT--FSTIMGV----SLRNELRRS 209
            .||..          ||....|:|..||.|  |..::||    .|...|||:
  Fly   208 RKMNF----------IVSQSAMLIATGATTVAFVQLLGVLCAFMLAKTLRRN 249

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tsp42ErNP_523644.1 Tetraspannin 8..195 CDD:278750 54/227 (24%)
tetraspanin_LEL 93..174 CDD:239401 24/109 (22%)
Tsp29FbNP_001137809.1 Tetraspannin 14..246 CDD:278750 58/242 (24%)
tetraspanin_LEL 110..218 CDD:239401 26/119 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3882
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR19282
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.