DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tsp42Er and Tsp26A

DIOPT Version :9

Sequence 1:NP_523644.1 Gene:Tsp42Er / 35629 FlyBaseID:FBgn0033139 Length:211 Species:Drosophila melanogaster
Sequence 2:NP_001097093.1 Gene:Tsp26A / 33838 FlyBaseID:FBgn0031760 Length:314 Species:Drosophila melanogaster


Alignment Length:306 Identity:74/306 - (24%)
Similarity:104/306 - (33%) Gaps:119/306 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 IRYLAFLFNFLCAVLGIATIVV---------------NVIAIDQIAPKDQLILGLYIAVGSIVFL 57
            ::||.|..|   .:|.::.::|               |:..:..||.....:|   |.:|.:.||
  Fly    19 LKYLLFASN---VILWLSALLVLSVGIWAWSEKGMFRNIARLHFIALDPAFVL---IILGGVTFL 77

  Fly    58 LSFFGCFGAIKESICVTWAYATSMLVMLIVSI---VMLFV-----------------FRMHFEED 102
            |.|.|..||::|:.|:..|||..:.|:||..|   .:.||                 |..|:.||
  Fly    78 LGFMGSVGALRENTCLLGAYAIFLSVLLIAEIGFCAVAFVLKDKGWIKDQATEGLKAFIRHYRED 142

  Fly   103 SITKLKQAFAKQTNTFDAMAEYQTQYQCCGIYKLKDY-GDAYIT-------------VPSSC--- 150
                     |.|.|..|.:.|  ...|||||...||: .:.|..             ||.||   
  Fly   143 ---------ADQQNLIDWIQE--DWLQCCGIDGPKDWDSNNYFNCSSIAIGSREACGVPFSCCRR 196

  Fly   151 ------------YDQNDTPY---------------RD-----------GCLAKMETQYEELL--- 174
                        ||.....|               .|           ||:|.:..|..||.   
  Fly   197 RPQEVIKNKQCGYDVRKEGYPVDRNIHERGCLRAGEDWLEAHLISVAIGCVALLVLQGMELSKII 261

  Fly   175 --KGPKIVG--WM---LMVIE--IGAFTFSTIMGVSLRNELRRSAY 211
              ||....|  ||   |::|.  :....|..|:|:.....||...|
  Fly   262 YEKGCVQAGEEWMEHNLIIISATVIVVMFFQILGICFAQNLRADIY 307

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tsp42ErNP_523644.1 Tetraspannin 8..195 CDD:278750 68/288 (24%)
tetraspanin_LEL 93..174 CDD:239401 32/152 (21%)
Tsp26ANP_001097093.1 Tetraspannin 18..253 CDD:278750 58/250 (23%)
DUF2207 <65..157 CDD:303056 30/105 (29%)
TM4SF9_like_LEL 118..239 CDD:239412 25/131 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45442897
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3882
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR19282
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.