DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tsp42Er and Tsp5D

DIOPT Version :9

Sequence 1:NP_523644.1 Gene:Tsp42Er / 35629 FlyBaseID:FBgn0033139 Length:211 Species:Drosophila melanogaster
Sequence 2:NP_001259266.1 Gene:Tsp5D / 31540 FlyBaseID:FBgn0029837 Length:287 Species:Drosophila melanogaster


Alignment Length:218 Identity:43/218 - (19%)
Similarity:82/218 - (37%) Gaps:61/218 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    47 LYIAVGSIVFLLSFFGCFGAIKESICVTWAYATSMLVMLIVSIVML-----------FVFRMHFE 100
            :::.:|...|::|||||.||        |..:..:||:..:.||||           |:||....
  Fly    56 IFMGIGGTGFVVSFFGCCGA--------WVQSRCLLVLYFMLIVMLFMSEFLVGSIAFLFRGGLG 112

  Fly   101 EDSITKLKQAFAKQTNTFDAMA-----------EYQTQYQCCGIYKLKDYGDAYI-----TVPSS 149
            .....:|:....:..|:.|..:           ..|..::|||:...:|:.|...     .||.|
  Fly   113 RTLANELRFGIERHYNSSDRGSLVAPSVASIWDSVQQSFECCGVSSYEDWYDIQSWPGRRWVPES 177

  Fly   150 C----YDQ-------------------NDTP---YRDGCLAKMETQYEELLKGPKIVGWMLMVIE 188
            |    |||                   ::.|   :..||...:::.:...|.....||..:..::
  Fly   178 CCRTLYDQRQVLTEGSGDGMMRPDCGRSENPSLWWDKGCAHSLQSWFTGQLNVVGAVGLGIAFVQ 242

  Fly   189 IGAFTFSTIMGVSLRNELRRSAY 211
            :.....|.::..:::::.....|
  Fly   243 LFGLITSMLLFCTVKHKRASDTY 265

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tsp42ErNP_523644.1 Tetraspannin 8..195 CDD:278750 41/200 (21%)
tetraspanin_LEL 93..174 CDD:239401 22/122 (18%)
Tsp5DNP_001259266.1 Tetraspannin 8..256 CDD:278750 42/207 (20%)
NET-5_like_LEL 105..228 CDD:239418 22/122 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3882
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR19282
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.