DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tsp42Er and Tsp2A

DIOPT Version :9

Sequence 1:NP_523644.1 Gene:Tsp42Er / 35629 FlyBaseID:FBgn0033139 Length:211 Species:Drosophila melanogaster
Sequence 2:NP_001188523.1 Gene:Tsp2A / 31080 FlyBaseID:FBgn0024361 Length:244 Species:Drosophila melanogaster


Alignment Length:227 Identity:49/227 - (21%)
Similarity:89/227 - (39%) Gaps:37/227 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 IRYLAFLFNFLCAVLGIATIVVNV-IAID-------QIAPKDQLILGLYIAVG-SIVFL-LSFFG 62
            ::|..|.||.:..::..|...:.| :..:       :|.......:|:|:.:| |||.: :||.|
  Fly    19 VKYTLFCFNIVAWMISTALFALTVWLRAEPGFNDWLRILEAQSFYIGVYVLIGISIVMMAVSFLG 83

  Fly    63 CFGAIKESICVTWAYATSMLVMLIVSIVMLFVFRMHFEEDSITKLKQAFAKQTNTFDAMAEY--- 124
            |..|:.|:....:.:..:. |...::||......:.|...: :.|:.........|.|.:||   
  Fly    84 CLSALMENTLALFVFVGTQ-VFGFIAIVAGSAVLLQFSTIN-SSLQPLLNVSLRGFVATSEYTYS 146

  Fly   125 -------QTQYQCCGIYKLKDYGDAYITVPSSCYDQ-NDTPYRDGCLAKMETQYEELLKGPKIVG 181
                   |....|||.....||.|....:||||.|. :...:.:||:.::...:|..      .|
  Fly   147 NYVLTMIQENIGCCGATGPWDYLDLRQPLPSSCRDTVSGNAFFNGCVDELTWFFEGK------TG 205

  Fly   182 WM--------LMVIEIGAFTFSTIMGVSLRNE 205
            |:        |:.:.....:|..:..|....|
  Fly   206 WIVALAMTLGLLNVICAVMSFVLVQAVKKEEE 237

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tsp42ErNP_523644.1 Tetraspannin 8..195 CDD:278750 46/215 (21%)
tetraspanin_LEL 93..174 CDD:239401 21/91 (23%)
Tsp2ANP_001188523.1 Tetraspannin 18..232 CDD:278750 47/220 (21%)
tetraspanin_LEL 116..204 CDD:239401 21/94 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3882
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR19282
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.