DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tsp42Er and Tspan3

DIOPT Version :9

Sequence 1:NP_523644.1 Gene:Tsp42Er / 35629 FlyBaseID:FBgn0033139 Length:211 Species:Drosophila melanogaster
Sequence 2:NP_001005547.1 Gene:Tspan3 / 300733 RGDID:1359444 Length:253 Species:Rattus norvegicus


Alignment Length:183 Identity:48/183 - (26%)
Similarity:84/183 - (45%) Gaps:44/183 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    49 IAVGSIVFLLSFFGCFGAIKESICVTWAYATSMLVML------IVSIVMLFVFRMHFEED---SI 104
            :|||:::|::...||...|:||.|   ..||.:.::|      :|.:|:.:|:|...|.:   ||
  Rat    58 MAVGALLFIIGLIGCCATIRESRC---GLATFVFILLLVFVTEVVVVVLGYVYRAKVENEVDRSI 119

  Fly   105 TKLKQAFAKQTNTFDAMA---EY-QTQYQCCGIYKLKDYGDA-------YITVPSSCYDQN---- 154
            .|:.:.: ..||: ||.:   :| |.|..||||:...|:.:.       ..:||.||..:.    
  Rat   120 QKVYKTY-NGTNS-DAASRAIDYVQRQLHCCGIHNYSDWENTDWFKETKNQSVPLSCCRETARSC 182

  Fly   155 -------DTPYRDGCLAKMETQYEELLKGPKIVGWMLMVIEIGAFTFSTIMGV 200
                   ...|.:||.|.:..:.:|:|..   |.|..:     ||....::|:
  Rat   183 NGSLANPSDLYAEGCEALVVKKLQEILMH---VIWAAL-----AFAAIQLLGM 227

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tsp42ErNP_523644.1 Tetraspannin 8..195 CDD:278750 47/176 (27%)
tetraspanin_LEL 93..174 CDD:239401 27/105 (26%)
Tspan3NP_001005547.1 Tetraspannin 10..237 CDD:278750 48/183 (26%)
TM4SF8_like_LEL 104..210 CDD:239416 27/107 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3882
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1406905at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.