DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tsp42Er and CG30160

DIOPT Version :10

Sequence 1:NP_523644.1 Gene:Tsp42Er / 35629 FlyBaseID:FBgn0033139 Length:211 Species:Drosophila melanogaster
Sequence 2:NP_724526.1 Gene:CG30160 / 246490 FlyBaseID:FBgn0050160 Length:222 Species:Drosophila melanogaster


Alignment Length:72 Identity:16/72 - (22%)
Similarity:30/72 - (41%) Gaps:21/72 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   181 LKQATSYSGNAGDSISRHAGMKFTTYDRDNDAAPY---NCAKKHRGGWWYHQQCVTSNLNGVYGN 242
            |::....|.|:.:::|..||          :|.|.   |.|::        :..|..|.||...|
  Fly    26 LEECAQKSANSSNAVSSTAG----------EARPETVPNTARR--------RSIVNRNDNGSENN 72

  Fly   243 TFSDQSN 249
            :..:::|
  Fly    73 SDGNETN 79

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tsp42ErNP_523644.1 Tetraspanin 8..195 CDD:459767 3/13 (23%)
CG30160NP_724526.1 Tetraspanin 8..216 CDD:459767 16/72 (22%)

Return to query results.
Submit another query.