DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tsp42Er and tsp-7

DIOPT Version :9

Sequence 1:NP_523644.1 Gene:Tsp42Er / 35629 FlyBaseID:FBgn0033139 Length:211 Species:Drosophila melanogaster
Sequence 2:NP_492636.1 Gene:tsp-7 / 192062 WormBaseID:WBGene00006633 Length:232 Species:Caenorhabditis elegans


Alignment Length:241 Identity:58/241 - (24%)
Similarity:103/241 - (42%) Gaps:52/241 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 MIRYLAFLFNFLCAVLGIATIVVNVI---AIDQIAPKDQLILG--------LYIAVGSIVFLLSF 60
            :::||.||.|.:..|.|::.|:|..|   ..|.:..    |||        |.:.:||:..||.|
 Worm     8 IVKYLLFLANLVLWVGGLSLIIVGSILQLKFDNVLD----ILGDERLATPILLLVIGSLCTLLGF 68

  Fly    61 FGCFGAIKESICVTWAYATSMLVMLIVSIVMLFV-FRMHFEEDSITKLKQAFAKQTNTFDAMAEY 124
            .||.|||:|:.|:|.::|..:.:::...|..:.: :.:|   ||   .:.....|..|  .|..|
 Worm    69 LGCCGAIRENYCLTVSFAVLLALLITCEIAAVIIGYALH---DS---FRLGIGNQLQT--GMVRY 125

  Fly   125 QTQ-------------YQCCGIYKLKDYGDAYITVPSS--------CYDQNDTPYRDGCLAKMET 168
            ...             ::|||:....|: ..:.|:|.|        |..:|...:..||:..:| 
 Worm   126 HESRGVESAWDKTHQLFECCGVTNSSDW-LTFTTIPDSCCIEEIEGCARENAPLFEPGCIHSVE- 188

  Fly   169 QYEELLKGPKIVGW---MLMVIEIGAFTFSTIMGVSLRNELRRSAY 211
              :.:||...:||.   :|..|::....|:..:..|:..:.....|
 Worm   189 --QWVLKNGAMVGGICAVLAAIQLVGVCFACCLSKSILKDFHDFYY 232

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tsp42ErNP_523644.1 Tetraspannin 8..195 CDD:278750 55/222 (25%)
tetraspanin_LEL 93..174 CDD:239401 19/102 (19%)
tsp-7NP_492636.1 Tetraspannin 8..223 CDD:278750 56/230 (24%)
NET-5_like_LEL 104..195 CDD:239418 21/102 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3882
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.