DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tsp42Er and tsp-4

DIOPT Version :9

Sequence 1:NP_523644.1 Gene:Tsp42Er / 35629 FlyBaseID:FBgn0033139 Length:211 Species:Drosophila melanogaster
Sequence 2:NP_502396.2 Gene:tsp-4 / 192060 WormBaseID:WBGene00006630 Length:241 Species:Caenorhabditis elegans


Alignment Length:226 Identity:50/226 - (22%)
Similarity:90/226 - (39%) Gaps:35/226 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 LFNFLCAVLGIATIVVNVI----AIDQIAPKDQLILG---------------------LYIAVGS 53
            |.|||..:|.:..|||.|:    :|..|..:.::.:.                     :.|.:|.
 Worm     9 LANFLFFILNLGLIVVGVMITWYSIWMILHQFEVTVARTSLVSFLSVDNIEWFYVYRTISIMIGG 73

  Fly    54 IVFLLSFFGCFGAI---KESICVTWAYATSMLVMLIVSIVMLFVFRMHFEEDSI----TKLKQAF 111
            .:.:|...|||...   |.::.|.......:.|:.||:|||....:.|...:.:    .:|...:
 Worm    74 CMVVLGLCGCFAVCFGSKTALSVHLVLVFLVFVVKIVAIVMFLANKDHLRREFVGVYRDELVANY 138

  Fly   112 AKQTNTFDAMAEYQTQYQCCGIYKLKDYGDAYITVPSSCY--DQNDTPYRDGCLAKMETQYEELL 174
            ...:.|.:.:....|..:|||....:|:..|. ..|:||.  .:|.....:||.......:|:..
 Worm   139 HNNSRTKNTLDWVHTSLKCCGANGCEDFLPAG-NFPTSCECGTKNAMVRMEGCALITWAVFEDGT 202

  Fly   175 KGPKIVGWMLMVIEIGAFTFSTIMGVSLRNE 205
            .....:|.:.|:||:|...|:.|:...:|.|
 Worm   203 LQVAFLGLICMLIELGLMIFAAIVIDRIRRE 233

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tsp42ErNP_523644.1 Tetraspannin 8..195 CDD:278750 46/214 (21%)
tetraspanin_LEL 93..174 CDD:239401 16/86 (19%)
tsp-4NP_502396.2 Tetraspannin 11..223 CDD:278750 45/212 (21%)
tetraspanin_LEL 116..191 CDD:239401 14/75 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3882
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.