DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tsp42Er and tsp-8

DIOPT Version :9

Sequence 1:NP_523644.1 Gene:Tsp42Er / 35629 FlyBaseID:FBgn0033139 Length:211 Species:Drosophila melanogaster
Sequence 2:NP_510445.1 Gene:tsp-8 / 181567 WormBaseID:WBGene00006634 Length:282 Species:Caenorhabditis elegans


Alignment Length:217 Identity:47/217 - (21%)
Similarity:82/217 - (37%) Gaps:56/217 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MGWSPLMIRYLAFLFNFLCAVLGIATIVVNVIAIDQIAPKDQLIL-----GLY-------IAVGS 53
            ||.....:|.:.|||||...:.|:....:.:..:...|..|...|     |.:       :..|:
 Worm     1 MGSCVNALRIVTFLFNFAFWLSGVVVFGLGIWLLFDPAASDFFALHSTHPGAFRYVGWFLVGAGA 65

  Fly    54 IVFLLSFFGCFGAIKESICVTWAYATSMLVML----IVSIVMLFVFRMHF----EEDSITKLKQA 110
            |:.|:.:|||.||.|.:.|.. |:...:|::.    :.:.|.||..:.|.    |......::..
 Worm    66 IIILVGYFGCIGAWKMNQCAL-AFFCCILILAFFLELAAAVTLFHKQEHIKHYVESSMYDTIRNR 129

  Fly   111 FAKQTNTFDAMAEYQTQYQCCGIYKLKDY----------------------------------GD 141
            ::.:|...||....|.:::|||:....|:                                  |.
 Worm   130 YSSETAFKDAFDTVQEKFECCGVKTYTDWLSARWDAEPSTQLEVNEEDAGRIEHGIGAFGGNKGT 194

  Fly   142 AYITVPSSCYDQN-DTPYRDGC 162
            .|..|||||.::: ...|.:.|
 Worm   195 GYGRVPSSCCNEHGKLSYPNNC 216

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tsp42ErNP_523644.1 Tetraspannin 8..195 CDD:278750 45/210 (21%)
tetraspanin_LEL 93..174 CDD:239401 20/109 (18%)
tsp-8NP_510445.1 Tetraspannin 8..276 CDD:278750 45/210 (21%)
Heme_Cu_Oxidase_I 13..>108 CDD:294196 23/95 (24%)
tetraspanin_LEL 108..243 CDD:239401 20/109 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3882
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.