DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tsp42Er and tspan2b

DIOPT Version :9

Sequence 1:NP_523644.1 Gene:Tsp42Er / 35629 FlyBaseID:FBgn0033139 Length:211 Species:Drosophila melanogaster
Sequence 2:XP_005161955.1 Gene:tspan2b / 101883842 ZFINID:ZDB-GENE-100922-60 Length:212 Species:Danio rerio


Alignment Length:223 Identity:55/223 - (24%)
Similarity:96/223 - (43%) Gaps:52/223 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 IRYLAFLFNFLCAVLGIATIVV--------NVIAIDQIAPKDQLILGLY--IAVGSIVFLLSFFG 62
            :::|.|:|||:..::|...:.|        |.:::......|...:|:|  ||.|.:|.|:.|||
Zfish    11 VKFLLFIFNFIFWLMGSLVLAVGLWLRLDPNTVSLLGEDGPDTFFIGVYILIAAGGLVMLVGFFG 75

  Fly    63 CFGAIKESICVTWAYATSMLVML---IVSIVMLFVFR-------MHFEEDSITKLKQAFAKQTNT 117
            |.||::||.|:...:...:||:.   :.:.|..|:.:       .||.::|        |...|.
Zfish    76 CCGAVRESQCLLGLFFACLLVIFGAEVAAGVFGFINKDKIIQEIRHFYDES--------AGNNNN 132

  Fly   118 FDAMAEYQTQYQCCGIYKLKDYGDAYITVPSSCYDQNDTPYRDGCLAKMETQYEELLKGPKIVGW 182
            ...:..|.|...|||         :....||||   .:..:...|...:|..:...|   .|||:
Zfish   133 NATVQSYHTVLSCCG---------SSTVTPSSC---KNMVFNQTCDVAIEEFFNSKL---FIVGY 182

  Fly   183 M------LMVIEIGAFTFSTIMGVSLRN 204
            :      :|:|   ...||.::..::||
Zfish   183 VGIGIAGVMII---GMIFSMVLCCAIRN 207

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tsp42ErNP_523644.1 Tetraspannin 8..195 CDD:278750 51/212 (24%)
tetraspanin_LEL 93..174 CDD:239401 17/87 (20%)
tspan2bXP_005161955.1 Tetraspannin 10..205 CDD:278750 53/219 (24%)
tetraspanin_LEL 109..177 CDD:243179 17/87 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.