DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tsp42Er and XB5740125

DIOPT Version :9

Sequence 1:NP_523644.1 Gene:Tsp42Er / 35629 FlyBaseID:FBgn0033139 Length:211 Species:Drosophila melanogaster
Sequence 2:XP_002934840.1 Gene:XB5740125 / 100145428 XenbaseID:XB-GENE-5740126 Length:245 Species:Xenopus tropicalis


Alignment Length:196 Identity:45/196 - (22%)
Similarity:78/196 - (39%) Gaps:42/196 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 SPLMIRYLAFLFNFLCAVLGIATIV-VNVIAIDQIAPKDQLIL---GLYIAVGSIVFLL--SFFG 62
            |.|.:|.||.||......|..|... :......|....|:.||   |:  ||....||:  ...|
 Frog     9 SRLCLRILALLFWTAAGCLLYAGYYNIKTYKSYQSFFHDRYILIPSGM--AVTGTFFLVINGLLG 71

  Fly    63 CFGAIKESICVTWAYATSMLVMLIVS-----IVMLFVFRMHFEEDSITKLKQAFAKQTNTFD--- 119
            |..:.|.|.|....:...::::|.:.     :..|::.||.||   :..:.:||    ..:|   
 Frog    72 CCISKKGSRCQQGCFMYFVVIVLCLEASAAVLAFLYMDRMDFE---LKPMLEAF----ENYDGSK 129

  Fly   120 ---AMAEYQTQYQCCGIYKLKDYGDA-----YITVPSSCYDQNDTP-----------YRDGCLAK 165
               .:.:.|.:.:|||::...|:...     ..|:|.:|.::..|.           |::||..|
 Frog   130 SDVTVNKIQKELRCCGLHNYTDWEATSWYRQNFTIPKTCCNETYTTCYGNTTESKAFYQEGCFDK 194

  Fly   166 M 166
            :
 Frog   195 L 195

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tsp42ErNP_523644.1 Tetraspannin 8..195 CDD:278750 43/192 (22%)
tetraspanin_LEL 93..174 CDD:239401 20/96 (21%)
XB5740125XP_002934840.1 Tetraspannin 9..222 CDD:366035 45/196 (23%)
tetraspanin_LEL 104..204 CDD:351888 21/99 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1406905at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.