DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tsp42Eq and CD63

DIOPT Version :9

Sequence 1:NP_523643.2 Gene:Tsp42Eq / 35628 FlyBaseID:FBgn0033138 Length:219 Species:Drosophila melanogaster
Sequence 2:NP_001244318.1 Gene:CD63 / 967 HGNCID:1692 Length:238 Species:Homo sapiens


Alignment Length:246 Identity:57/246 - (23%)
Similarity:96/246 - (39%) Gaps:56/246 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 GTKALKVSSFVLDFLCCVLAALTIAACSYALIAFSHSV------AIRVPSILGIVLGGLLFFSTI 62
            |.|.:|...:||....|..|...||....|.:..|.::      ...:|.:: |.:|..||....
Human     6 GMKCVKFLLYVLLLAFCACAVGLIAVGVGAQLVLSQTIIQGATPGSLLPVVI-IAVGVFLFLVAF 69

  Fly    63 FGCIAALRESIRMTWIYAAILLALVFSQITVILAQPINYELLANETIYDAWQGQL------YHS- 120
            .||..|.:|:..:...:|..|..::..::...:|..:..:.:.:| ..:.::.|:      .|: 
Human    70 VGCCGACKENYCLMITFAIFLSLIMLVEVAAAIAGYVFRDKVMSE-FNNNFRQQMENYPKNNHTA 133

  Fly   121 ---DRMSYFEIKYHCCGQTGPANYPD-------SGLVIPQSCYFNQNATVTTDLYTVGC--NHQL 173
               |||   :..:.||   |.|||.|       |...:|.||..|         .||||  |...
Human   134 SILDRM---QADFKCC---GAANYTDWEKIPSMSKNRVPDSCCIN---------VTVGCGINFNE 183

  Fly   174 AAAFVKGTRWEKITDW-------------SVVGVEILTVIIAGLLAITLQN 211
            .|...:|. .|||..|             .:..||:|.::.|..|..::::
Human   184 KAIHKEGC-VEKIGGWLRKNVLVVAAAALGIAFVEVLGIVFACCLVKSIRS 233

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tsp42EqNP_523643.2 Tetraspannin 8..209 CDD:278750 55/238 (23%)
tetraspanin_LEL 95..173 CDD:239401 24/96 (25%)
CD63NP_001244318.1 Tetraspannin 10..227 CDD:395265 54/234 (23%)
CD63_LEL 105..203 CDD:239419 29/114 (25%)
Lysosomal targeting motif. /evidence=ECO:0000250|UniProtKB:P41731 234..238 57/246 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3882
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.