DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tsp42Eq and CD37

DIOPT Version :9

Sequence 1:NP_523643.2 Gene:Tsp42Eq / 35628 FlyBaseID:FBgn0033138 Length:219 Species:Drosophila melanogaster
Sequence 2:XP_005259492.1 Gene:CD37 / 951 HGNCID:1666 Length:365 Species:Homo sapiens


Alignment Length:290 Identity:63/290 - (21%)
Similarity:100/290 - (34%) Gaps:97/290 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 SCGTKALKVSSFVLDFLCCVLAALTIAACSYALI---AFSHSVAI---------RVPSILGIVLG 54
            || ...:|...||.:....||.:|......:.||   :|...|.:         :|.:|.||...
Human     6 SC-LSLIKYFLFVFNLFFFVLGSLIFCFGIWILIDKTSFVSFVGLAFVPLQIWSKVLAISGIFTM 69

  Fly    55 GLLFFSTIFGCIAALRESIRMTWIYAAILLALVFSQITV-ILAQPINYEL------LANETI--Y 110
            |:    .:.||:.||:|...:..:|..:||.|..:|||: ||......:|      :..:||  |
Human    70 GI----ALLGCVGALKELRCLLGLYFGMLLLLFATQITLGILISTQRAQLERSLRDVVEKTIQKY 130

  Fly   111 DAWQGQLYHSDRMSYFEIKYHCCGQTGPANYPDSGLV-------------IPQSCYFNQNATVTT 162
            .....:....:...|.:.:..|||.    :||.....             :|.|||   |.:.|.
Human   131 GTNPEETAAEESWDYVQFQLRCCGW----HYPQDWFQVLILRGNGSEAHRVPCSCY---NLSATN 188

  Fly   163 D-----------------------------------LYTVGCNHQLAAAFVKGTRWEKITDWSVV 192
            |                                   :|..||...|       .:|......|:|
Human   189 DSTILDKVILPQLSRLGHLARSRHSADICAVPAESHIYREGCAQGL-------QKWLHNNLISIV 246

  Fly   193 GVEI------LTVIIAGLLAITLQNAERRR 216
            |:.:      :||::   |::.||....||
Human   247 GICLGVGLLEMTVMV---LSVQLQRRALRR 273

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tsp42EqNP_523643.2 Tetraspannin 8..209 CDD:278750 57/275 (21%)
tetraspanin_LEL 95..173 CDD:239401 21/133 (16%)
CD37XP_005259492.1 Tetraspannin 26..269 CDD:278750 54/263 (21%)
CD37_CD82_like_LEL 108..243 CDD:239413 22/148 (15%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3882
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR19282
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.