Sequence 1: | NP_523643.2 | Gene: | Tsp42Eq / 35628 | FlyBaseID: | FBgn0033138 | Length: | 219 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_011518638.1 | Gene: | TSPAN4 / 7106 | HGNCID: | 11859 | Length: | 269 | Species: | Homo sapiens |
Alignment Length: | 207 | Identity: | 43/207 - (20%) |
---|---|---|---|
Similarity: | 80/207 - (38%) | Gaps: | 30/207 - (14%) |
- Green bases have known domain annotations that are detailed below.
Fly 19 CCVL-AALTIAACSYALIAFSHSVAIRVPSILGIVLGGLLFFSTIFGCIAALRES--IRMTWIYA 80
Fly 81 AIL-------LALVFSQITVILAQPINYELLANETIYDAWQGQLYHSDRMSYFEIKYHCCGQTGP 138
Fly 139 ANYPD-----SGLVIPQSCYFNQNATVTTDLYTVGCNHQLAAAFVKGTRWEKITDWSVVGVEILT 198
Fly 199 VIIAGLLAITLQ 210 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Tsp42Eq | NP_523643.2 | Tetraspannin | 8..209 | CDD:278750 | 42/204 (21%) |
tetraspanin_LEL | 95..173 | CDD:239401 | 15/82 (18%) | ||
TSPAN4 | XP_011518638.1 | Tetraspannin | 63..261 | CDD:278750 | 40/200 (20%) |
NET-5_like_LEL | 136..233 | CDD:239418 | 19/111 (17%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG3882 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 1 | 1.100 | - | - | O | PTHR19282 |
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
3 | 2.910 |