DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tsp42Eq and TSPAN4

DIOPT Version :9

Sequence 1:NP_523643.2 Gene:Tsp42Eq / 35628 FlyBaseID:FBgn0033138 Length:219 Species:Drosophila melanogaster
Sequence 2:XP_011518638.1 Gene:TSPAN4 / 7106 HGNCID:11859 Length:269 Species:Homo sapiens


Alignment Length:207 Identity:43/207 - (20%)
Similarity:80/207 - (38%) Gaps:30/207 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 CCVL-AALTIAACSYALIAFSHSVAIRVPSILGIVLGGLLFFSTIFGCIAALRES--IRMTWIYA 80
            |.|| ..:.:||...:....|.|......:.|.|:.|..:......||:.|::|:  :.:|:...
Human    56 CGVLGVGIWLAATQGSFATLSSSFPSLSAANLLIITGAFVMAIGFVGCLGAIKENKCLLLTFFLL 120

  Fly    81 AIL-------LALVFSQITVILAQPINYELLANETIYDAWQGQLYHSDRMSYFEIKYHCCGQTGP 138
            .:|       :|::|...|..:.:....:|.....:|.. ||.:..::..|..:..:.||   |.
Human   121 LLLVFLLEATIAILFFAYTDKIDRYAQQDLKKGLHLYGT-QGNVGLTNAWSIIQTDFRCC---GV 181

  Fly   139 ANYPD-----SGLVIPQSCYFNQNATVTTDLYTVGCNHQLAAAFVKGTRWEKITDWSVVGVEILT 198
            :||.|     :...:|.||...         ::..|.......:.|...:|.:..|  :...:|.
Human   182 SNYTDWFEVYNATRVPDSCCLE---------FSESCGLHAPGTWWKAPCYETVKVW--LQENLLA 235

  Fly   199 VIIAGLLAITLQ 210
            |.|.||....:|
Human   236 VGIFGLCTALVQ 247

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tsp42EqNP_523643.2 Tetraspannin 8..209 CDD:278750 42/204 (21%)
tetraspanin_LEL 95..173 CDD:239401 15/82 (18%)
TSPAN4XP_011518638.1 Tetraspannin 63..261 CDD:278750 40/200 (20%)
NET-5_like_LEL 136..233 CDD:239418 19/111 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3882
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR19282
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.