DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tsp42Eq and Tspan1

DIOPT Version :9

Sequence 1:NP_523643.2 Gene:Tsp42Eq / 35628 FlyBaseID:FBgn0033138 Length:219 Species:Drosophila melanogaster
Sequence 2:NP_598442.1 Gene:Tspan1 / 66805 MGIID:1914055 Length:240 Species:Mus musculus


Alignment Length:270 Identity:64/270 - (23%)
Similarity:92/270 - (34%) Gaps:90/270 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSCGTKALKVSSFVLDFLCCVLAALTIAACSYALIAFSHSVAIRVPSILG--------------- 50
            |.| .|.:||..|:.:.|        |..|..||:|....|::...|.|.               
Mouse     1 MQC-FKFIKVMMFLFNLL--------IFLCGAALLAVGIWVSVDGTSFLKVFGSLSSSAMQFVNV 56

  Fly    51 ----IVLGGLLFFSTIFGCIAALRESIRMTWIYAAILL------------ALVFS----QITVIL 95
                |..|.:||.....||..|..|:..:..::.:|||            |||::    |...:|
Mouse    57 GYFLIAAGAVLFILGFLGCYGAHSENKCVLMMFFSILLIIFIAEIAGAVVALVYTTLAEQFLTLL 121

  Fly    96 AQPINYELLANETIYDAWQGQLYHSDRMSYFEI---KYHCCGQTGPANYPD--------SGLVIP 149
            ..|      |.|..|.      |.:|....:..   :.||||..   ||.|        ...|.|
Mouse   122 VVP------AIEKDYG------YQTDFTQVWNTTMEELHCCGFN---NYTDFNASRFVKENKVFP 171

  Fly   150 QSCYFNQ-NATVTTDLYTVGCNHQLAAAF-VKG--------TRWEKITDWSV-VGV---EILTVI 200
            ..|..|. |.||..      |..:.|.:. |:|        .|...:|...| |||   |:..::
Mouse   172 PPCCANPGNHTVEP------CTEEKAKSMKVQGCFKEILHRIRANAVTVGGVAVGVAALELAAMV 230

  Fly   201 IAGLLAITLQ 210
            ::..|...|:
Mouse   231 VSMYLYCNLK 240

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tsp42EqNP_523643.2 Tetraspannin 8..209 CDD:278750 60/260 (23%)
tetraspanin_LEL 95..173 CDD:239401 22/89 (25%)
Tspan1NP_598442.1 Tetraspannin 7..235 CDD:366035 59/256 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3882
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR19282
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.